Search Antibody, Protein, and ELISA Kit Solutions

RBX1 Antibody - middle region : FITC (AVARP03042_T100-FITC)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP03042_T100 Unconjugated

AVARP03042_T100-HRP Conjugated

AVARP03042_T100-Biotin Conjugated

Gene Symbol:
RBX1
Official Gene Full Name:
Ring-box 1, E3 ubiquitin protein ligase
NCBI Gene Id:
9978
Swissprot Id:
P62877
Protein Accession #:
NP_055063
Nucleotide Accession #:
NM_014248
Alias Symbols:
ROC1, RNF75, BA554C12.1
Replacement Item:
This antibody may replace item sc-366959 from Santa Cruz Biotechnology.
Description of Target:
ROC1 encodes an evolutionarily conserved protein that interacts with cullins. The protein plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization. It also may be involved in the regulation of protein turn-over.
Protein Size (# AA):
108
Molecular Weight:
12kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RBX1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-RBX1 (AVARP03042_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
CDT1; CDC34; KEAP1; UBE2L6; UBE2M; CUL1; CUL3; CUL4B; UBE2D3; UBE2D2; UBE2D1; DAB2IP; UBC; TP53; PRAME; DCUN1D1; CUL2; DCUN1D3; MAP4K1; VHL; NEDD4; MTSS1; VRK2; HIST1H4A; GFPT1; CTNNB1; CCNE1; DCUN1D5; FBXL5; RHOBTB3; SAMHD1; UBC12; FBXL15; UBE2R2; SERTAD
Blocking Peptide:
For anti-RBX1 (AVARP03042_T100-FITC) antibody is Catalog # AAP30461 (Previous Catalog # AAPP01045)
Datasheets/Manuals:
Printable datasheet for anti-RBX1 (AVARP03042_T100-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Zheng, N., et al., (2002) Nature 416 (6882), 703-709.
Publications:

Maerki, S. et al. The Cul3-KLHL21 E3 ubiquitin ligase targets aurora B to midzone microtubules in anaphase and is required for cytokinesis. J. Cell Biol. 187, 791-800 (2009). WB, Bovine, Dog, Guinea pig, Human, Mouse, Rat, Zebrafish 19995937

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...