PCDHA6 Antibody (OAAL00751)

Catalog No: OAAL00751

Size:100UG

PCDHA6 monoclonal antibody (M05), clone 1A3. Western Blot analysis of PCDHA6 expression in K-562.

Detection limit for recombinant GST tagged PCDHA6 is approximately 0.3ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1A3
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: PCDHA6 (NP_061732, 295 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: IDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLPVREDAQFGTVIA
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: PCDHA6
• Gene Full Name: protocadherin alpha 6
• Alias Symbols: CNR2;CNRN2;CNRS2;CRNR2;KIAA0345-like 8;PCDH-alpha-6;PCDH-ALPHA6;protocadherin alpha-6.
• NCBI Gene Id: 56142
• Protein Name: Homo sapiens protocadherin alpha 6 (PCDHA6), transcript variant 1, mRNA|protocadherin alpha-6 isoform 1 precursor [Homo sapiens]
• Description of Target: This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_061732
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_018909