Search Antibody, Protein, and ELISA Kit Solutions

NPM1 Antibody - N-terminal region (ARP34094_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34094_T100-FITC Conjugated

ARP34094_T100-HRP Conjugated

ARP34094_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-116348 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human NPM1
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 77%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NPM1 (ARP34094_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NPM1 (ARP34094_T100) antibody is Catalog # AAP34094 (Previous Catalog # AAPP05303)
Printable datasheet for anti-NPM1 (ARP34094_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that NPM1 is expressed in HepG2

Target Reference:
Falini,B., et al., (2005) N. Engl. J. Med. 352 (3), 254-266

Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 20053746

Lin, S., Coutinho-Mansfield, G., Wang, D., Pandit, S. & Fu, X.-D. The splicing factor SC35 has an active role in transcriptional elongation. Nat. Struct. Mol. Biol. 15, 819-26 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 18641664

Gene Symbol:
Official Gene Full Name:
Nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Alias Symbols:
B23, NPM
NCBI Gene Id:
Protein Name:
Description of Target:
NPM1 is a member of Nucleophosmin (NPM) family. NPM is a ubiquitously expressed nucleolar phosphoprotein that continuously shuttles between the nucleus and cytoplasm
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NPM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NPM1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...