Search Antibody, Protein, and ELISA Kit Solutions

NPM1 Antibody - C-terminal region (ARP34114_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34114_T100-FITC Conjugated

ARP34114_T100-HRP Conjugated

ARP34114_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human, Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NPM1
Official Gene Full Name:
Nucleophosmin (nucleolar phosphoprotein B23, numatrin)
NCBI Gene Id:
4869
Protein Name:
Nucleophosmin
Swissprot Id:
P06748
Protein Accession #:
NP_954654
Nucleotide Accession #:
NM_199185
Alias Symbols:
B23, NPM
Replacement Item:
This antibody may replace item sc-116348 from Santa Cruz Biotechnology.
Description of Target:
NPM3 is a member of Nucleophosmin (NPM) family. NPM is a ubiquitously expressed nucleolar phosphoprotein that continuously shuttles between the nucleus and cytoplasm
Protein Size (# AA):
265
Molecular Weight:
29kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NPM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NPM1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NPM1
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 92%
Complete computational species homology data:
Anti-NPM1 (ARP34114_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DDDFDDEEAEEKAPVKKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
COX8A; NPM2; HUWE1; UBC; PA2G4; FUS; TP53; AURKA; SUMO2; SUMO3; ELF4; STAU1; CDKN2A; LGR4; SUMO1; MDM2; RPA3; RPA2; RPA1; ERG; rev; TRMT61A; OSBP; KPNA1; LIMCH1; ARMCX3; YWHAQ; PARK2; TARDBP; TUBA1C; TAB2; CEP152; DZIP1; COPG1; STK38; COPE; PARK7; AKAP11;
Blocking Peptide:
For anti-NPM1 (ARP34114_T100) antibody is Catalog # AAP34114 (Previous Catalog # AAPP05587)
Datasheets/Manuals:
Printable datasheet for anti-NPM1 (ARP34114_T100) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that NPM1 is expressed in HepG2

Target Reference:
Falini,B., et al., (2005) N. Engl. J. Med. 352 (3), 254-266

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: NPM1 antibody - C-terminal region (ARP34114_T100) in MIA PaCa-2 human pancreatic cancer, MDA-MB-231 Human breast carcinoma and HUH 7 hepatocarcinoma cell line using Western blot
Product page for NPM1 antibody - C-terminal region (ARP34114_T100)

Researcher: Andrei L. Gartel, University of Illinois at Chicago
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 25ug MIA PaCa-2 cell lysate Lane 2: 25ug MDA-MB-231 cell lysate Lane 3: 25ug Huh-7 cell lysate
Primary antibody dilution: 1:2000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? We haven't used them until the trial.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4: -some background bands
Would you use this antibody in future experiments? May be
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? May be.
How did you store the antibody after re-suspension? 4 degree C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human cancer cells; 25 ng
How many different experimental trials were conducted using the antibody sample? One
How was this sample prepared? Cells were lysed in 20mM Hepes, 1% Triton-X-100, 150mM NaCl, 1mM EDTA, 1mM EGTA, 100 mM NaF, 10mM Na4P2O7, 1mM Na3VO4, 0.2mM PMSF containing buffer.
Primary antibody dilution and incubation time:  1:2000; overnight at 4 degree C
Secondary antibody used and dilution and incubation time:  1:5000; 1 hr at room temp.; Jackson Immunoresearch
What controls were used in your experiment (positive/negative)? Our own corresponding antibodies.
Please include your detailed WB Procedure/Protocol here:  - Samples were mix on 10% gel in 1X running buffer (Tris-Glycine-SDS).
- Transfered to PVDF membrane in trannsfer buffer (Tris-Glycine-MeOH) for 24hrs at 48V.
- Blocked in 5% milk (in TBST) for 1 hr at room temp.
- Primary1:2000 overnight at 4 degree C.
- Washed 3X 15 min in TBST.
- Secondary 1:5000 1 hr at room temp.
- Washed 3x 15 min in TBST.
- Substrate (Thermo scientific #34080) for 5 min and expose film for 30 sec, 3 min or overnight.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...