Search Antibody, Protein, and ELISA Kit Solutions

MED25 Antibody - C-terminal region (ARP50699_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP50699_P050-FITC Conjugated

ARP50699_P050-HRP Conjugated

ARP50699_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-149352 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human MED25
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-MED25 (ARP50699_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED25 (ARP50699_P050) antibody is Catalog # AAP50699
Datasheets/Manuals:
Printable datasheet for anti-MED25 (ARP50699_P050) antibody
Gene Symbol:
MED25
Official Gene Full Name:
mediator complex subunit 25
Alias Symbols:
P78, ACID1, ARC92, BVSYS, PTOV2, CMT2B2, TCBAP0758
NCBI Gene Id:
81857
Protein Name:
mediator of RNA polymerase II transcription subunit 25
Description of Target:
This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Swissprot Id:
Q71SY5
Protein Accession #:
NP_112235.2
Nucleotide Accession #:
NM_030973.3
Protein Size (# AA):
233
Molecular Weight:
25kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED25.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED25.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...