MED25 Antibody - C-terminal region (ARP50699_P050)

Data Sheet
 
Product Number ARP50699_P050
Product Page www.avivasysbio.com/med25-antibody-c-terminal-region-arp50699-p050.html
Name MED25 Antibody - C-terminal region (ARP50699_P050)
Protein Size (# AA) 233 amino acids
Molecular Weight 25kDa
NCBI Gene Id 81857
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mediator complex subunit 25
Description
Alias Symbols P78, ACID1, ARC92, BVSYS, PTOV2, CMT2B2, TCBAP0758
Peptide Sequence Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MED25 (ARP50699_P050) antibody
Blocking Peptide For anti-MED25 (ARP50699_P050) antibody is Catalog # AAP50699
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human MED25
Uniprot ID Q71SY5
Protein Name mediator of RNA polymerase II transcription subunit 25
Publications

ETV4 and AP1 Transcription Factors Form Multivalent Interactions with three Sites on the MED25 Activator-Interacting Domain. J Mol Biol. 429, 2975-2995 (2017). 28728983

Protein Accession # NP_112235.2
Purification Affinity Purified
Nucleotide Accession # NM_030973.3
Tested Species Reactivity Human
Gene Symbol MED25
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Image 2
Human OVCAR-3
Host: Rabbit
Target Name: MED25
Sample Type: OVCAR-3 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com