Product Number |
ARP50699_P050 |
Product Page |
www.avivasysbio.com/med25-antibody-c-terminal-region-arp50699-p050.html |
Name |
MED25 Antibody - C-terminal region (ARP50699_P050) |
Protein Size (# AA) |
233 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
81857 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
mediator complex subunit 25 |
Description |
|
Alias Symbols |
P78, ACID1, ARC92, BVSYS, PTOV2, CMT2B2, TCBAP0758 |
Peptide Sequence |
Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MED25 (ARP50699_P050) antibody |
Blocking Peptide |
For anti-MED25 (ARP50699_P050) antibody is Catalog # AAP50699 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human MED25 |
Uniprot ID |
Q71SY5 |
Protein Name |
mediator of RNA polymerase II transcription subunit 25 |
Publications |
ETV4 and AP1 Transcription Factors Form Multivalent Interactions with three Sites on the MED25 Activator-Interacting Domain. J Mol Biol. 429, 2975-2995 (2017). 28728983 |
Protein Accession # |
NP_112235.2 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_030973.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
MED25 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB, CHIP |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | HCT116
| Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site. |
|
Image 2 | Human OVCAR-3
| Host: Rabbit Target Name: MED25 Sample Type: OVCAR-3 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|