Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

MED25 Antibody - N-terminal region (ARP50698_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50698_P050-FITC Conjugated

ARP50698_P050-HRP Conjugated

ARP50698_P050-Biotin Conjugated

Gene Symbol:
MED25
Official Gene Full Name:
Mediator complex subunit 25
NCBI Gene Id:
81857
Protein Name:
Mediator of RNA polymerase II transcription subunit 25
Swissprot Id:
Q71SY5
Protein Accession #:
NP_112235
Nucleotide Accession #:
NM_030973
Alias Symbols:
ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758
Replacement Item:
This antibody may replace item sc-149352 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Protein Size (# AA):
747
Molecular Weight:
78kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, CHIP
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED25.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED25.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MED25
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MED25 (ARP50698_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MED19; MED26; EPAS1; NOTCH1; DREB2A; CTDP1; MED6; THRA; RXRA; RARA; MED1; NR3C1; ESR1; CREBBP; SREBF1; MED25; MED15; MED16; MED13; MED12; MED7; MED17; MED23; MED14; CDK8; ZC3H13; QKI; TRIP4; TADA2A; MED28; OBFC1; TRRAP; UL48; MED9; MED8; HCFC1; MED10
Blocking Peptide:
For anti-MED25 (ARP50698_P050) antibody is Catalog # AAP50698 (Previous Catalog # AAPP44777)
Datasheets/Manuals:
Printable datasheet for anti-MED25 (ARP50698_P050) antibody
Subunit:
25
Publications:

Sela, D. et al. Role for human mediator subunit MED25 in recruitment of mediator to promoters by endoplasmic reticulum stress-responsive transcription factor ATF6-alpha. J. Biol. Chem. 288, 26179-87 (2013). WB, CHIP, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish 23864652

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...