Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP50698_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP50698_P050-FITC Conjugated

ARP50698_P050-HRP Conjugated

ARP50698_P050-Biotin Conjugated

MED25 Antibody - N-terminal region (ARP50698_P050)

Catalog#: ARP50698_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, CHIP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-149352 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MED25
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-MED25 (ARP50698_P050)
Peptide SequenceSynthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MED25 (ARP50698_P050) antibody is Catalog # AAP50698 (Previous Catalog # AAPP44777)
Datasheets/ManualsPrintable datasheet for anti-MED25 (ARP50698_P050) antibody
Subunit25
Publications

Sela, D. et al. Role for human mediator subunit MED25 in recruitment of mediator to promoters by endoplasmic reticulum stress-responsive transcription factor ATF6-alpha. J. Biol. Chem. 288, 26179-87 (2013). WB, CHIP, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish 23864652

Gene SymbolMED25
Official Gene Full NameMediator complex subunit 25
Alias SymbolsACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758
NCBI Gene Id81857
Protein NameMediator of RNA polymerase II transcription subunit 25
Description of TargetThis gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Swissprot IdQ71SY5
Protein Accession #NP_112235
Nucleotide Accession #NM_030973
Protein Size (# AA)747
Molecular Weight78kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MED25.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MED25.
Protein InteractionsUBC; MED19; MED26; EPAS1; NOTCH1; DREB2A; CTDP1; MED6; THRA; RXRA; RARA; MED1; NR3C1; ESR1; CREBBP; SREBF1; MED25; MED15; MED16; MED13; MED12; MED7; MED17; MED23; MED14; CDK8; ZC3H13; QKI; TRIP4; TADA2A; MED28; OBFC1; TRRAP; UL48; MED9; MED8; HCFC1; MED10
Write Your Own Review
You're reviewing:MED25 Antibody - N-terminal region (ARP50698_P050)
Your Rating
Aviva Blast Tool
Assay Development
Aviva Live Chat
Aviva Tissue Tool