Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP50698_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP50698_P050-FITC Conjugated

ARP50698_P050-HRP Conjugated

ARP50698_P050-Biotin Conjugated

MED25 Antibody - N-terminal region (ARP50698_P050)

Catalog#: ARP50698_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-149352 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MED25
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-MED25 (ARP50698_P050)
Peptide Sequence Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MED25 (ARP50698_P050) antibody is Catalog # AAP50698 (Previous Catalog # AAPP44777)
Datasheets/Manuals Printable datasheet for anti-MED25 (ARP50698_P050) antibody
Subunit 25
Publications

Sela, D. et al. Role for human mediator subunit MED25 in recruitment of mediator to promoters by endoplasmic reticulum stress-responsive transcription factor ATF6-alpha. J. Biol. Chem. 288, 26179-87 (2013). WB, CHIP, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish 23864652

Gene Symbol MED25
Official Gene Full Name Mediator complex subunit 25
Alias Symbols ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758
NCBI Gene Id 81857
Protein Name Mediator of RNA polymerase II transcription subunit 25
Description of Target This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Swissprot Id Q71SY5
Protein Accession # NP_112235
Nucleotide Accession # NM_030973
Protein Size (# AA) 747
Molecular Weight 78kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MED25.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MED25.
Protein Interactions UBC; MED19; MED26; EPAS1; NOTCH1; DREB2A; CTDP1; MED6; THRA; RXRA; RARA; MED1; NR3C1; ESR1; CREBBP; SREBF1; MED25; MED15; MED16; MED13; MED12; MED7; MED17; MED23; MED14; CDK8; ZC3H13; QKI; TRIP4; TADA2A; MED28; OBFC1; TRRAP; UL48; MED9; MED8; HCFC1; MED10
  1. What is the species homology for "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish".

  2. How long will it take to receive "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MED25 Antibody - N-terminal region (ARP50698_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    This target may also be called "ACID1, ARC92, CMT2B2, DKFZp434K0512, MGC70671, P78, PTOV2, TCBAP0758" in publications.

  5. What is the shipping cost for "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MED25 Antibody - N-terminal region (ARP50698_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MED25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MED25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MED25"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MED25"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MED25"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MED25"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MED25 Antibody - N-terminal region (ARP50698_P050)
Your Rating
We found other products you might like!