SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58139_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP58139_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-MED14 (ARP58139_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB, CHIP
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MED14
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 79%; Rabbit: 86%
Peptide SequenceSynthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
Concentration0.5 mg/ml
Blocking PeptideFor anti-MED14 (ARP58139_P050-FITC) antibody is Catalog # AAP58139 (Previous Catalog # AAPP43619)
Sample Type Confirmation

MED14 is strongly supported by BioGPS gene expression data to be expressed in A549

Subunit14
Gene SymbolMED14
Gene Full NameMediator complex subunit 14
Alias SymbolsCSRP, RGR1, CRSP2, EXLM1, CXorf4, CRSP150, DRIP150, TRAP170
NCBI Gene Id9282
Protein NameMediator of RNA polymerase II transcription subunit 14
Description of TargetThe activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
Uniprot IDO60244
Protein Accession #NP_004220
Nucleotide Accession #NM_004229
Protein Size (# AA)1454
Molecular Weight160kDa
Protein InteractionsUBC; HECW2; CDK8; CDK19; MED12; ESR1; MED19; MED26; PPARG; FBXW7; EPAS1; MED11; MED8; MED29; MED18; MED4; PPP6R1; MED16; MED13; MED24; MED27; MED17; MED21; MED1; CTDP1; SREBF1; DCTN1; ACTN2; ACTN1; MED10; UACA; NECAB2; MED25; MED15; CRSP5; MED7; MED23; VD
  1. What is the species homology for "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rabbit".

  2. How long will it take to receive "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    This target may also be called "CSRP, RGR1, CRSP2, EXLM1, CXorf4, CRSP150, DRIP150, TRAP170" in publications.

  5. What is the shipping cost for "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "160kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MED14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MED14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MED14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MED14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MED14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MED14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MED14 Antibody - middle region : FITC (ARP58139_P050-FITC)
Your Rating
We found other products you might like!