Size:100 ul
$319.00
In Stock
SKU
ARP58139_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58139_P050-FITC Conjugated

ARP58139_P050-HRP Conjugated

ARP58139_P050-Biotin Conjugated

MED14 Antibody - middle region (ARP58139_P050)

Catalog#: ARP58139_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Mouse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-142586 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MED14
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 79%; Rabbit: 86%
Complete computational species homology data Anti-MED14 (ARP58139_P050)
Peptide Sequence Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MED14 (ARP58139_P050) antibody is Catalog # AAP58139 (Previous Catalog # AAPP43619)
Datasheets/Manuals Printable datasheet for anti-MED14 (ARP58139_P050) antibody
Sample Type Confirmation

MED14 is strongly supported by BioGPS gene expression data to be expressed in A549

Subunit 14
Gene Symbol MED14
Official Gene Full Name Mediator complex subunit 14
Alias Symbols CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, MGC104513, RGR1, TRAP170
NCBI Gene Id 9282
Protein Name Mediator of RNA polymerase II transcription subunit 14
Description of Target The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
Swissprot Id O60244
Protein Accession # NP_004220
Nucleotide Accession # NM_004229
Protein Size (# AA) 1454
Molecular Weight 160kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MED14.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MED14.
Protein Interactions UBC; HECW2; CDK8; CDK19; MED12; ESR1; MED19; MED26; PPARG; FBXW7; EPAS1; MED11; MED8; MED29; MED18; MED4; PPP6R1; MED16; MED13; MED24; MED27; MED17; MED21; MED1; CTDP1; SREBF1; DCTN1; ACTN2; ACTN1; MED10; UACA; NECAB2; MED25; MED15; CRSP5; MED7; MED23; VD
  1. What is the species homology for "MED14 Antibody - middle region (ARP58139_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rabbit".

  2. How long will it take to receive "MED14 Antibody - middle region (ARP58139_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MED14 Antibody - middle region (ARP58139_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MED14 Antibody - middle region (ARP58139_P050)"?

    This target may also be called "CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, MGC104513, RGR1, TRAP170" in publications.

  5. What is the shipping cost for "MED14 Antibody - middle region (ARP58139_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MED14 Antibody - middle region (ARP58139_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MED14 Antibody - middle region (ARP58139_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "160kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MED14 Antibody - middle region (ARP58139_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MED14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MED14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MED14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MED14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MED14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MED14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MED14 Antibody - middle region (ARP58139_P050)
Your Rating
We found other products you might like!