Search Antibody, Protein, and ELISA Kit Solutions

MED14 Antibody - middle region (ARP58139_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58139_P050-FITC Conjugated

ARP58139_P050-HRP Conjugated

ARP58139_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human, Mouse, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-142586 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MED14
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 79%; Rabbit: 86%
Complete computational species homology data:
Anti-MED14 (ARP58139_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED14 (ARP58139_P050) antibody is Catalog # AAP58139 (Previous Catalog # AAPP43619)
Datasheets/Manuals:
Printable datasheet for anti-MED14 (ARP58139_P050) antibody
Sample Type Confirmation:

MED14 is strongly supported by BioGPS gene expression data to be expressed in A549

Subunit:
14
Gene Symbol:
MED14
Official Gene Full Name:
Mediator complex subunit 14
Alias Symbols:
CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, MGC104513, RGR1, TRAP170
NCBI Gene Id:
9282
Protein Name:
Mediator of RNA polymerase II transcription subunit 14
Description of Target:
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
Swissprot Id:
O60244
Protein Accession #:
NP_004220
Nucleotide Accession #:
NM_004229
Protein Size (# AA):
1454
Molecular Weight:
160kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED14.
Protein Interactions:
UBC; HECW2; CDK8; CDK19; MED12; ESR1; MED19; MED26; PPARG; FBXW7; EPAS1; MED11; MED8; MED29; MED18; MED4; PPP6R1; MED16; MED13; MED24; MED27; MED17; MED21; MED1; CTDP1; SREBF1; DCTN1; ACTN2; ACTN1; MED10; UACA; NECAB2; MED25; MED15; CRSP5; MED7; MED23; VD

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...