| Sku |
AAP58139 |
| Old sku |
AAPP43619 |
| Price |
$99.00 |
| Name |
MED14 Peptide - middle region (AAP58139) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
MED14 |
| Alias symbols |
CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, MGC104513, RGR1, TRAP170 |
| Gene id |
9282 |
| Description of target |
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation. |
| Swissprot id |
O60244 |
| Protein accession num |
NP_004220 |
| Nucleotide accession num |
NM_004229 |
| Protein size |
1454 amino acids |
| Molecular weight |
160kDa |
| Species reactivity |
Human |
| Application |
WB, CHIP |
| Peptide sequence |
AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE |
| Partner proteins |
ACTN1,ACTN2,AR,HNF4A,MED1,MED29,MED9,NR3C1,STAT2,UACA,BRD4,CDK8,ESR1,ESR2,GATA1,HNF4A,MED1,MED10,MED19,MED21,MED26,MED28,MED29,MED6,MED9,MYC,NR3C1,PPARGC1A,STAT2,VDR |
| Subunit |
14 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-MED14 Antibody(ARP58139_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
