- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for MCM3AP Antibody (OAAL00423) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 1H3 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | MCM3AP (AAH13285, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | MCM3AP |
|---|---|
| Gene Full Name | minichromosome maintenance complex component 3 associated protein |
| Alias Symbols | 80 kDa MCM3-associated protein;GANP;germinal center-associated nuclear protein;germinal-center associated nuclear protein;germinal-centre associated nuclear protein;MAP80;MCM3 acetylating protein;MCM3 acetyltransferase;MCM3 import protein;MCM3 minichromosome maintenance deficient 3 associated protein;PNRIID;SAC3. |
| NCBI Gene Id | 8888 |
| Protein Name | Homo sapiens minichromosome maintenance complex component 3 associated protein, mRNA (cDNA clone IMAGE:4099986), partial cds|MCM3AP protein, partial [Homo sapiens] |
| Description of Target | The minichromosome maintenance protein 3 (MCM3) is one of the MCM proteins essential for the initiation of DNA replication. The protein encoded by this gene is a MCM3 binding protein. It was reported to have phosphorylation-dependent DNA-primase activity, which was up-regulated in antigen immunization induced germinal center. This protein was demonstrated to be an acetyltransferase that acetylates MCM3 and plays a role in DNA replication. The mutagenesis of a nuclear localization signal of MCM3 affects the binding of this protein with MCM3, suggesting that this protein may also facilitate MCM3 nuclear localization. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH13285 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC013285 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MCM3AP Antibody (OAAL00423)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "MCM3AP Antibody (OAAL00423)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "MCM3AP Antibody (OAAL00423)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MCM3AP Antibody (OAAL00423)"?
This target may also be called "80 kDa MCM3-associated protein;GANP;germinal center-associated nuclear protein;germinal-center associated nuclear protein;germinal-centre associated nuclear protein;MAP80;MCM3 acetylating protein;MCM3 acetyltransferase;MCM3 import protein;MCM3 minichromosome maintenance deficient 3 associated protein;PNRIID;SAC3." in publications.
-
What is the shipping cost for "MCM3AP Antibody (OAAL00423)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MCM3AP Antibody (OAAL00423)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MCM3AP Antibody (OAAL00423)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MCM3AP Antibody (OAAL00423)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MCM3AP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MCM3AP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MCM3AP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MCM3AP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MCM3AP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MCM3AP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
