- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for INTS6 Antibody (OAAL00635) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid. Supplied in 1x PBS, pH 7.4. |
Clonality | Monoclonal |
Clone | 3D9 |
Isotype | IgG1 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | DDX26 (NP_036273, 779 a.a. ~ 887 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN |
Gene Symbol | INTS6 |
---|---|
Gene Full Name | integrator complex subunit 6 |
Alias Symbols | DBI-1;DDX26;DDX26A;DEAD box protein;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26;DICE1;HDB;INT6;integrator complex subunit 6;Notchl2;protein deleted in cancer 1;RNA helicase HDB. |
NCBI Gene Id | 26512 |
Protein Name | Homo sapiens integrator complex subunit 6 (INTS6), transcript variant 1, mRNA|integrator complex subunit 6 isoform a [Homo sapiens] |
Description of Target | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH). Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_036273 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_012141 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "INTS6 Antibody (OAAL00635)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "INTS6 Antibody (OAAL00635)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "INTS6 Antibody (OAAL00635)" provided in?
This item is provided in "Liquid. Supplied in 1x PBS, pH 7.4.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "INTS6 Antibody (OAAL00635)"?
This target may also be called "DBI-1;DDX26;DDX26A;DEAD box protein;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26;DICE1;HDB;INT6;integrator complex subunit 6;Notchl2;protein deleted in cancer 1;RNA helicase HDB." in publications.
-
What is the shipping cost for "INTS6 Antibody (OAAL00635)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "INTS6 Antibody (OAAL00635)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "INTS6 Antibody (OAAL00635)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "INTS6 Antibody (OAAL00635)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "INTS6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "INTS6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "INTS6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "INTS6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "INTS6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "INTS6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.