- Gene Symbol:
- IL1A
- NCBI Gene Id:
- 3552
- Official Gene Full Name:
- Interleukin 1, alpha
- Protein Name:
- Interleukin-1 alpha
- Swissprot Id:
- P01583
- Protein Accession #:
- NP_000566
- Nucleotide Accession #:
- NM_000575
- Alias Symbols:
- IL-1A, IL1, IL1-ALPHA, IL1F1
- Replacement Item:
- This antibody may replace item sc-111172 from Santa Cruz Biotechnology.
- Description of Target:
- The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. The gene encoding IL1A and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Protein Size (# AA):
- 271
- Molecular Weight:
- 18kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express IL1A.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express IL1A.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 92%; Dog: 85%; Goat: 85%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 79%; Sheep: 85%
- Complete computational species homology data:
- Anti-IL1A (ARP54322_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- HFI1; AHC1; GCN5; SPT7; ADA2; NGG1; SPT8; HAX1; NFKBIE; IL1RAP; NDN; S100A13; IL1R2; IL1R1; IL1A; CAPN1;
- Blocking Peptide:
- For anti-IL1A (ARP54322_P050) antibody is Catalog # AAP54322 (Previous Catalog # AAPP31070)
- Datasheets/Manuals:
- Printable datasheet for anti-IL1A (ARP54322_P050) antibody
- Target Reference:
- Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
- Publications:
Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). WB, Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep 23083102
Zheng, Y., Humphry, M., Maguire, J. J., Bennett, M. R. & Clarke, M. C. H. Intracellular interleukin-1 receptor 2 binding prevents cleavage and activity of interleukin-1-alpha, controlling necrosis-induced sterile inflammation. Immunity 38, 285-95 (2013). WB, Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep 23395675
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
