Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP54322_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54322_P050-FITC Conjugated

ARP54322_P050-HRP Conjugated

ARP54322_P050-Biotin Conjugated

IL1A Antibody - N-terminal region (ARP54322_P050)

Catalog#: ARP54322_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111172 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 85%; Goat: 85%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 79%; Sheep: 85%
Complete computational species homology data Anti-IL1A (ARP54322_P050)
Peptide Sequence Synthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IL1A (ARP54322_P050) antibody is Catalog # AAP54322 (Previous Catalog # AAPP31070)
Datasheets/Manuals Printable datasheet for anti-IL1A (ARP54322_P050) antibody
Target Reference Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
Publications

Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). WB, Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep 23083102

Zheng, Y., Humphry, M., Maguire, J. J., Bennett, M. R. & Clarke, M. C. H. Intracellular interleukin-1 receptor 2 binding prevents cleavage and activity of interleukin-1-alpha, controlling necrosis-induced sterile inflammation. Immunity 38, 285-95 (2013). WB, Cow, Dog, Goat, Horse, Human, Mouse, Rat, Sheep 23395675

Gene Symbol IL1A
Official Gene Full Name Interleukin 1, alpha
Alias Symbols IL-1A, IL1, IL1-ALPHA, IL1F1
NCBI Gene Id 3552
Protein Name Interleukin-1 alpha
Description of Target The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. The gene encoding IL1A and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P01583
Protein Accession # NP_000566
Nucleotide Accession # NM_000575
Protein Size (# AA) 271
Molecular Weight 18kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IL1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IL1A.
Protein Interactions HFI1; AHC1; GCN5; SPT7; ADA2; NGG1; SPT8; HAX1; NFKBIE; IL1RAP; NDN; S100A13; IL1R2; IL1R1; IL1A; CAPN1;
Write Your Own Review
You're reviewing:IL1A Antibody - N-terminal region (ARP54322_P050)
Your Rating