IL1A Antibody - N-terminal region (ARP54322_P050)

• Product Number: ARP54322_P050
• Name: IL1A Antibody - N-terminal region (ARP54322_P050)
• Protein Size (# AA): 271 amino acids
• Molecular Weight: 31 kDa
• NCBI Gene Id: 3552
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interleukin 1, alpha
• Alias Symbols: IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha
• Peptide Sequence: Synthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
• Description of Target: The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. The gene encoding IL1A and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: HFI1; AHC1; GCN5; SPT7; ADA2; NGG1; SPT8; HAX1; NFKBIE; IL1RAP; NDN; S100A13; IL1R2; IL1R1; IL1A; CAPN1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-IL1A (ARP54322_P050) antibody is Catalog # AAP54322 (Previous Catalog # AAPP31070)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A
• Uniprot ID: P01583
• Protein Name: Interleukin-1 alpha
• Publications:

  Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). 23083102

  Zheng, Y., Humphry, M., Maguire, J. J., Bennett, M. R. & Clarke, M. C. H. Intracellular interleukin-1 receptor 2 binding prevents cleavage and activity of interleukin-1a, controlling necrosis-induced sterile inflammation. Immunity 38, 285-95 (2013). 23395675

• Protein Accession #: NP_000566
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000575
• Tested Species Reactivity: Human
• Gene Symbol: IL1A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 85%; Goat: 85%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 79%; Sheep: 85%
• Image 1:
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.