Search Antibody, Protein, and ELISA Kit Solutions

HDAC3 Antibody - C-terminal region : FITC (ARP74556_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74556_P050 Unconjugated

ARP74556_P050-HRP Conjugated

ARP74556_P050-Biotin Conjugated

Gene Symbol:
HDAC3
NCBI Gene Id:
8841
Swissprot Id:
O15379
Protein Accession #:
NP_003874
Alias Symbols:
HDAC3,
Replacement Item:
This antibody may replace item sc-11417 from Santa Cruz Biotechnology.
Description of Target:
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Protein Size (# AA):
428
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HDAC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HDAC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HDAC3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PPARG; NFE2L2; CSNK2A1; SAP30; MEF2A; SMAD7; HIF1A; NCOR2; PRDM6; GPS2; ZBTB16; SUMO1; RREB1; TCP1; TBL1X; SOX2; HDAC7; ANKRD11; APPL1; ANKRD12; RCOR1; KDM1A; CCT5; NCOR1; HDAC3; CCT3; TBL1XR1; RCOR3; CCT8; CCT2; CCT4; CCT7; CCT6A; TRIM28; STAT3; vif; ZBT
Blocking Peptide:
For anti-HDAC3 (ARP74556_P050-FITC) antibody is Catalog # AAP74556
Datasheets/Manuals:
Printable datasheet for anti-HDAC3 (ARP74556_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...