Size:100 ul
$289.00
In Stock
SKU
ARP74556_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74556_P050 Unconjugated

ARP74556_P050-HRP Conjugated

ARP74556_P050-Biotin Conjugated

HDAC3 Antibody - C-terminal region : FITC (ARP74556_P050-FITC)

Catalog#: ARP74556_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-11417 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human HDAC3
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Concentration0.5 mg/ml
Blocking PeptideFor anti-HDAC3 (ARP74556_P050-FITC) antibody is Catalog # AAP74556
Datasheets/ManualsPrintable datasheet for anti-HDAC3 (ARP74556_P050-FITC) antibody
Gene SymbolHDAC3
Alias SymbolsHDAC3,
NCBI Gene Id8841
Description of TargetHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Swissprot IdO15379
Protein Accession #NP_003874
Protein Size (# AA)428
Molecular Weight47kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HDAC3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HDAC3.
Protein InteractionsPPARG; NFE2L2; CSNK2A1; SAP30; MEF2A; SMAD7; HIF1A; NCOR2; PRDM6; GPS2; ZBTB16; SUMO1; RREB1; TCP1; TBL1X; SOX2; HDAC7; ANKRD11; APPL1; ANKRD12; RCOR1; KDM1A; CCT5; NCOR1; HDAC3; CCT3; TBL1XR1; RCOR3; CCT8; CCT2; CCT4; CCT7; CCT6A; TRIM28; STAT3; vif; ZBT
Write Your Own Review
You're reviewing:HDAC3 Antibody - C-terminal region : FITC (ARP74556_P050-FITC)
Your Rating
Free Microscope
Aviva Travel Grant
Aviva Tissue Tool
Aviva Live Chat