Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP74556_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74556_P050-FITC Conjugated

ARP74556_P050-HRP Conjugated

ARP74556_P050-Biotin Conjugated

HDAC3 Antibody - C-terminal region (ARP74556_P050)

Catalog#: ARP74556_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-11417 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human HDAC3
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HDAC3 (ARP74556_P050) antibody is Catalog # AAP74556
Datasheets/ManualsPrintable datasheet for anti-HDAC3 (ARP74556_P050) antibody
Gene SymbolHDAC3
Alias SymbolsHDAC3,
NCBI Gene Id8841
Description of TargetHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Swissprot IdO15379
Protein Accession #NP_003874
Protein Size (# AA)428
Molecular Weight47kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HDAC3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HDAC3.
Protein InteractionsPPARG; NFE2L2; CSNK2A1; SAP30; MEF2A; SMAD7; HIF1A; NCOR2; PRDM6; GPS2; ZBTB16; SUMO1; RREB1; TCP1; TBL1X; SOX2; HDAC7; ANKRD11; APPL1; ANKRD12; RCOR1; KDM1A; CCT5; NCOR1; HDAC3; CCT3; TBL1XR1; RCOR3; CCT8; CCT2; CCT4; CCT7; CCT6A; TRIM28; STAT3; vif; ZBT
Write Your Own Review
You're reviewing:HDAC3 Antibody - C-terminal region (ARP74556_P050)
Your Rating
Assay Development
Aviva Blast Tool
Aviva Pathways
Aviva HIS tag Deal