Catalog No: ARP50819_P050
Price: $0.00
SKU
ARP50819_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GTF2A1L (ARP50819_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-GTF2A1L (ARP50819_P050) antibody is Catalog # AAP50819 (Previous Catalog # AAPS29911)
ReferenceKim,M., (2006) J. Biol. Chem. 281 (45), 34288-34298
Gene SymbolGTF2A1L
Gene Full NameGeneral transcription factor IIA, 1-like
Alias SymbolsALF
NCBI Gene Id11036
Protein NameTFIIA-alpha and beta-like factor
Description of TargetThe assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Uniprot IDQ9UNN4
Protein Accession #NP_006863
Nucleotide Accession #NM_006872
Protein Size (# AA)478
Molecular Weight52kDa
Protein InteractionsGAB1; NKX2-3; ZBTB3; TLX3; MAFF; RBFOX2; HMG20A; PAX9; SIX6; MAFG; HOXC11; HOXC9; HOXA5; TLX2; EMX2; EMX1; CEBPE; ATF4; ASCL3; GTF2A2; SUB1; ID3; CSNK2A2; CSNK2A1; TBP;
  1. What is the species homology for "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse".

  2. How long will it take to receive "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "GTF2A1L Antibody - C-terminal region (ARP50819_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    This target may also be called "ALF" in publications.

  5. What is the shipping cost for "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "GTF2A1L Antibody - C-terminal region (ARP50819_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GTF2A1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GTF2A1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GTF2A1L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GTF2A1L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GTF2A1L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GTF2A1L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:GTF2A1L Antibody - C-terminal region (ARP50819_P050)
Your Rating
We found other products you might like!