Search Antibody, Protein, and ELISA Kit Solutions

GTF2A1L Antibody - C-terminal region (ARP50819_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50819_P050-FITC Conjugated

ARP50819_P050-HRP Conjugated

ARP50819_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
General transcription factor IIA, 1-like
NCBI Gene Id:
Protein Name:
TFIIA-alpha and beta-like factor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ALF, MGC26254
Replacement Item:
This antibody may replace item sc-130304 from Santa Cruz Biotechnology.
Description of Target:
The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GTF2A1L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GTF2A1L.
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%
Complete computational species homology data:
Anti-GTF2A1L (ARP50819_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GTF2A1L (ARP50819_P050) antibody is Catalog # AAP50819 (Previous Catalog # AAPS29911)
Printable datasheet for anti-GTF2A1L (ARP50819_P050) antibody
Target Reference:
Kim,M., (2006) J. Biol. Chem. 281 (45), 34288-34298

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...