GTF2A1L Antibody - C-terminal region (ARP50819_P050)

Data Sheet
 
Product Number ARP50819_P050
Product Page www.avivasysbio.com/gtf2a1l-antibody-c-terminal-region-arp50819-p050.html
Name GTF2A1L Antibody - C-terminal region (ARP50819_P050)
Protein Size (# AA) 478 amino acids
Molecular Weight 52kDa
NCBI Gene Id 11036
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name General transcription factor IIA, 1-like
Alias Symbols ALF
Peptide Sequence Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,M., (2006) J. Biol. Chem. 281 (45), 34288-34298
Description of Target The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Protein Interactions GAB1; NKX2-3; ZBTB3; TLX3; MAFF; RBFOX2; HMG20A; PAX9; SIX6; MAFG; HOXC11; HOXC9; HOXA5; TLX2; EMX2; EMX1; CEBPE; ATF4; ASCL3; GTF2A2; SUB1; ID3; CSNK2A2; CSNK2A1; TBP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2A1L (ARP50819_P050) antibody
Blocking Peptide For anti-GTF2A1L (ARP50819_P050) antibody is Catalog # AAP50819 (Previous Catalog # AAPS29911)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L
Uniprot ID Q9UNN4
Protein Name TFIIA-alpha and beta-like factor
Protein Accession # NP_006863
Purification Affinity Purified
Nucleotide Accession # NM_006872
Tested Species Reactivity Human
Gene Symbol GTF2A1L
Predicted Species Reactivity Human, Mouse, Rat, Dog, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%
Image 1
Human HepG2
WB Suggested Anti-GTF2A1L Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com