GTF2A1L Antibody - C-terminal region : FITC (ARP50819_P050-FITC)

Catalog No: ARP50819_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GTF2A1L (ARP50819_P050-FITC) antibody is Catalog # AAP50819 (Previous Catalog # AAPS29911)
• Reference: Kim,M., (2006) J. Biol. Chem. 281 (45), 34288-34298

Target Info

• Gene Symbol: GTF2A1L
• Gene Full Name: General transcription factor IIA, 1-like
• Alias Symbols: ALF
• NCBI Gene Id: 11036
• Protein Name: TFIIA-alpha and beta-like factor
• Description of Target: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
• Uniprot ID: Q9UNN4
• Protein Accession #: NP_006863
• Nucleotide Accession #: NM_006872
• Protein Size (# AA): 478
• Molecular Weight: 52kDa
• Protein Interactions: GAB1; NKX2-3; ZBTB3; TLX3; MAFF; RBFOX2; HMG20A; PAX9; SIX6; MAFG; HOXC11; HOXC9; HOXA5; TLX2; EMX2; EMX1; CEBPE; ATF4; ASCL3; GTF2A2; SUB1; ID3; CSNK2A2; CSNK2A1; TBP;