Search Antibody, Protein, and ELISA Kit Solutions

FOXA1 Antibody - N-terminal region (ARP38479_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38479_P050-FITC Conjugated

ARP38479_P050-HRP Conjugated

ARP38479_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Forkhead box A1
NCBI Gene Id:
Protein Name:
Hepatocyte nuclear factor 3-alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HNF3A, MGC33105, TCF3A
Replacement Item:
This antibody may replace item sc-101058 from Santa Cruz Biotechnology.
Description of Target:
FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FOXA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FOXA1.
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%; Rat: 93%; Zebrafish: 85%
Complete computational species homology data:
Anti-FOXA1 (ARP38479_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMN
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FOXA1 (ARP38479_P050) antibody is Catalog # AAP38479 (Previous Catalog # AAPP23402)
Printable datasheet for anti-FOXA1 (ARP38479_P050) antibody
Target Reference:
Lupien,M., (2008) Cell 132 (6), 958-970

Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22959654

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...