Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP38479_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38479_P050-FITC Conjugated

ARP38479_P050-HRP Conjugated

ARP38479_P050-Biotin Conjugated

FOXA1 Antibody - N-terminal region (ARP38479_P050)

Catalog#: ARP38479_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-101058 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%; Rat: 93%; Zebrafish: 85%
Complete computational species homology dataAnti-FOXA1 (ARP38479_P050)
Peptide SequenceSynthetic peptide located within the following region: LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FOXA1 (ARP38479_P050) antibody is Catalog # AAP38479 (Previous Catalog # AAPP23402)
Datasheets/ManualsPrintable datasheet for anti-FOXA1 (ARP38479_P050) antibody
Target ReferenceLupien,M., (2008) Cell 132 (6), 958-970
Publications

Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). WB, Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22959654

Gene SymbolFOXA1
Official Gene Full NameForkhead box A1
Alias SymbolsHNF3A, MGC33105, TCF3A
NCBI Gene Id3169
Protein NameHepatocyte nuclear factor 3-alpha
Description of TargetFOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP55317
Protein Accession #NP_004487
Nucleotide Accession #NM_004496
Protein Size (# AA)472
Molecular Weight49kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FOXA1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FOXA1.
Protein InteractionsEED; SEZ6L2; AHR; ELAVL1; SUMO2; TLE1; HDAC7; HIST3H3; AR; ONECUT1; DSCAM; NRIP1; XBP1; TFF1;
Write Your Own Review
You're reviewing:FOXA1 Antibody - N-terminal region (ARP38479_P050)
Your Rating
Free Microscope
Aviva Travel Grant
Aviva Blast Tool
Aviva ChIP Antibodies