FOXA1 Antibody - N-terminal region (ARP38479_P050)

• Product Number: ARP38479_P050
• Name: FOXA1 Antibody - N-terminal region (ARP38479_P050)
• Protein Size (# AA): 472 amino acids
• Molecular Weight: 49kDa
• NCBI Gene Id: 3169
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Forkhead box A1
• Alias Symbols: HNF3A, TCF3A
• Peptide Sequence: Synthetic peptide located within the following region: LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lupien,M., (2008) Cell 132 (6), 958-970
• Description of Target: FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: EED; SEZ6L2; AHR; ELAVL1; SUMO2; TLE1; HDAC7; HIST3H3; AR; ONECUT1; DSCAM; NRIP1; XBP1; TFF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXA1 (ARP38479_P050) antibody is Catalog # AAP38479 (Previous Catalog # AAPP23402)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
• Uniprot ID: P55317
• Protein Name: Hepatocyte nuclear factor 3-alpha
• Publications:

  Menga, A. et al. Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier. Eur. Neuropsychopharmacol. 23, 978-87 (2013). 22959654

• Protein Accession #: NP_004487
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004496
• Tested Species Reactivity: Human
• Gene Symbol: FOXA1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%; Rat: 93%; Zebrafish: 85%
• Image 1: Human 721_B
  
  WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysate
• Image 2: human ES
  
  Sample Type: 1. Control (20ug)
  2. shRNA1-FOXA1 H9 hES cells (20ug)
  3. shRNA2-FOXA1 H9 hES cells (20ug)
  Primary Dilution: 1:1000
  Secondary Antibody: anti-Rabbit HRP
  Secondary Dilution: 1:5000
  Image Submitted By: Jingli Cai
  Thomas Jefferson University