Catalog No: ARP57867_P050
Price: $0.00
SKU
ARP57867_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FOXA1 (ARP57867_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FOXA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM
Concentration0.5 mg/ml
Blocking PeptideFor anti-FOXA1 (ARP57867_P050) antibody is Catalog # AAP57867 (Previous Catalog # AAPP32220)
Sample Type Confirmation

FOXA1 is supported by BioGPS gene expression data to be expressed in HepG2, MCF7

Enhanced Validation
WBY
SPR
YCHAROS
ReferenceLupien,M., (2008) Cell 132 (6), 958-970
Gene SymbolFOXA1
Gene Full NameForkhead box A1
Alias SymbolsHNF3A, TCF3A
NCBI Gene Id3169
Protein NameHepatocyte nuclear factor 3-alpha
Description of TargetFOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP55317
Protein Accession #NP_004487
Nucleotide Accession #NM_004496
Protein Size (# AA)472
Molecular Weight49 kDa
Protein InteractionsEED; SEZ6L2; AHR; ELAVL1; SUMO2; TLE1; HDAC7; HIST3H3; AR; ONECUT1; DSCAM; NRIP1; XBP1; TFF1;
  1. What is the species homology for "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig".

  2. How long will it take to receive "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FOXA1 Antibody - N-terminal region (ARP57867_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    This target may also be called "HNF3A, TCF3A" in publications.

  5. What is the shipping cost for "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FOXA1 Antibody - N-terminal region (ARP57867_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FOXA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FOXA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FOXA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FOXA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FOXA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FOXA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FOXA1 Antibody - N-terminal region (ARP57867_P050)
Your Rating
We found other products you might like!