ENPP2 Antibody - N-terminal region (ARP44908_P050)

Catalog No: ARP44908_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: ENPP2
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 2ug/ml

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENPP2
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: QWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ENPP2 (ARP44908_P050) antibody is Catalog # AAP44908

Target Info

• Gene Symbol: ENPP2
• Gene Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 2
• Alias Symbols: ATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IALPHA
• NCBI Gene Id: 5168
• Protein Name: ectonucleotide pyrophosphatase/phosphodiesterase family member 2
• Description of Target: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q13822-2
• Protein Accession #: NP_001035181
• Nucleotide Accession #: NM_001040092.2
• Protein Size (# AA): 915
• Molecular Weight: 100 kDa
• Protein Interactions: ITGB4; LPAR1; Dlg4; UBD;