ENPP2 Antibody : HRP (ARP44908_P050-HRP)

Catalog No: ARP44908_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence IPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPL
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: IPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPL
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: ENPP2
• Gene Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 2
• Alias Symbols: ATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IALPHA
• NCBI Gene Id: 5168
• Protein Name: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
• Description of Target: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q13822
• Protein Accession #: NP_001035181
• Nucleotide Accession #: NM_001040092
• Protein Size (# AA): 863
• Molecular Weight: 99 kDa
• Protein Interactions: ITGB4; LPAR1; Dlg4; UBD;