SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP44908_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP44908_P050-Biotin
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ENPP2 (ARP44908_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence IPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: IPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPL
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolENPP2
Gene Full Nameectonucleotide pyrophosphatase/phosphodiesterase 2
Alias SymbolsATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IALPHA
NCBI Gene Id5168
Protein NameEctonucleotide pyrophosphatase/phosphodiesterase family member 2
Description of TargetThe protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDQ13822
Protein Accession #NP_001035181
Nucleotide Accession #NM_001040092
Protein Size (# AA)863
Molecular Weight99 kDa
Protein InteractionsITGB4; LPAR1; Dlg4; UBD;
  1. What is the species homology for "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    This target may also be called "ATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IALPHA" in publications.

  5. What is the shipping cost for "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "99 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ENPP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ENPP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ENPP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ENPP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ENPP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ENPP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ENPP2 Antibody : Biotin (ARP44908_P050-Biotin)
Your Rating
We found other products you might like!