Search Antibody, Protein, and ELISA Kit Solutions

ENO1 Antibody - C-terminal region (ARP34376_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34376_T100-FITC Conjugated

ARP34376_T100-HRP Conjugated

ARP34376_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ENO1
Official Gene Full Name:
Enolase 1, (alpha)
NCBI Gene Id:
2023
Protein Name:
Alpha-enolase
Swissprot Id:
Q53HR3
Protein Accession #:
NP_001419
Nucleotide Accession #:
NM_001428
Alias Symbols:
NNE, PPH, MPB1, ENO1L1
Replacement Item:
This antibody may replace item sc-100812 from Santa Cruz Biotechnology.
Description of Target:
ENO1 is one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.
Protein Size (# AA):
434
Molecular Weight:
47kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ENO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ENO1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ENO1
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 79%; Zebrafish: 79%
Complete computational species homology data:
Anti-ENO1 (ARP34376_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; FUS; HUWE1; ISG15; SUMO2; SUMO3; IVNS1ABP; STAU1; MDM2; WWOX; EED; FBXO6; UPF2; YWHAQ; UBD; TERT; SRC; RAD52; NPM1; BHLHE40; VCAM1; HCVgp1; ITGA4; FN1; ATF2; SERPING1; AMBP; LIG4; BRCA1; MDC1; PGK1; ITPA; GAPDH; FYN; FLNC; ENO3; Htt; TPI1; PPIA; AKT1
Blocking Peptide:
For anti-ENO1 (ARP34376_T100) antibody is Catalog # AAP34376 (Previous Catalog # AAPY00218)
Datasheets/Manuals:
Printable datasheet for anti-ENO1 (ARP34376_T100) antibody
Sample Type Confirmation:

ENO1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Ghosh,A.K., et al., (2005) J. Biol. Chem. 280 (14), 14325-14330
Publications:

Rambaruth, N. D. S., Greenwell, P. & Dwek, M. V. The lectin Helix pomatia agglutinin recognizes O-GlcNAc containing glycoproteins in human breast cancer. Glycobiology 22, 839-48 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish 22322011

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...