Size:100 ul
$249.00
In Stock
SKU
ARP34376_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34376_T100-FITC Conjugated

ARP34376_T100-HRP Conjugated

ARP34376_T100-Biotin Conjugated

ENO1 Antibody - C-terminal region (ARP34376_T100)

Catalog#: ARP34376_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-100812 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ENO1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 79%; Zebrafish: 79%
Complete computational species homology dataAnti-ENO1 (ARP34376_T100)
Peptide SequenceSynthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ENO1 (ARP34376_T100) antibody is Catalog # AAP34376 (Previous Catalog # AAPY00218)
Datasheets/ManualsPrintable datasheet for anti-ENO1 (ARP34376_T100) antibody
Sample Type Confirmation

ENO1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceGhosh,A.K., et al., (2005) J. Biol. Chem. 280 (14), 14325-14330
Publications

Rambaruth, N. D. S., Greenwell, P. & Dwek, M. V. The lectin Helix pomatia agglutinin recognizes O-GlcNAc containing glycoproteins in human breast cancer. Glycobiology 22, 839-48 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish 22322011

Gene SymbolENO1
Official Gene Full NameEnolase 1, (alpha)
Alias SymbolsNNE, PPH, MPB1, ENO1L1
NCBI Gene Id2023
Protein NameAlpha-enolase
Description of TargetENO1 is one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.
Swissprot IdQ53HR3
Protein Accession #NP_001419
Nucleotide Accession #NM_001428
Protein Size (# AA)434
Molecular Weight47kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ENO1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ENO1.
Protein InteractionsUBC; FUS; HUWE1; ISG15; SUMO2; SUMO3; IVNS1ABP; STAU1; MDM2; WWOX; EED; FBXO6; UPF2; YWHAQ; UBD; TERT; SRC; RAD52; NPM1; BHLHE40; VCAM1; HCVgp1; ITGA4; FN1; ATF2; SERPING1; AMBP; LIG4; BRCA1; MDC1; PGK1; ITPA; GAPDH; FYN; FLNC; ENO3; Htt; TPI1; PPIA; AKT1
Write Your Own Review
You're reviewing:ENO1 Antibody - C-terminal region (ARP34376_T100)
Your Rating
Aviva Travel Grant
Aviva Tissue Tool
Aviva Pathways
Aviva Validation Data