Loading...
Catalog No: ARP38030_P050
Price: $0.00
SKU
ARP38030_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Eno1 (ARP38030_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: YEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQL
Concentration0.5 mg/ml
Blocking PeptideFor anti-Eno1 (ARP38030_P050) antibody is Catalog # AAP38030 (Previous Catalog # AAPP20206)
Gene SymbolEno1
Gene Full NameEnolase 1, (alpha)
Alias SymbolsNne
NCBI Gene Id24333
Protein NameAlpha-enolase
Description of TargetEno1 is a multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. It may also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. It stimulates immunoglobulin production.
Uniprot IDP04764
Protein Accession #AAH90069
Nucleotide Accession #NM_001109908
Protein Size (# AA)434
Molecular Weight47kDa
Protein InteractionsGja1; Ubc;
  1. What is the species homology for "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Eno1 Antibody - N-terminal region (ARP38030_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    This target may also be called "Nne" in publications.

  5. What is the shipping cost for "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Eno1 Antibody - N-terminal region (ARP38030_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ENO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ENO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ENO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ENO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ENO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ENO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Eno1 Antibody - N-terminal region (ARP38030_P050)
Your Rating
We found other products you might like!