Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ENO1 Antibody - middle region (ARP34377_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34377_P050-FITC Conjugated

ARP34377_P050-HRP Conjugated

ARP34377_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Enolase 1, (alpha)
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100812 from Santa Cruz Biotechnology.
Description of Target:
ENO1 encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ENO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ENO1.
The immunogen is a synthetic peptide directed towards the middle region of human ENO1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-ENO1 (ARP34377_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ENO1 (ARP34377_P050) antibody is Catalog # AAP34377 (Previous Catalog # AAPY00219)
Printable datasheet for anti-ENO1 (ARP34377_P050) antibody
Target Reference:
Lee,K.H., et al., (2003) Arthritis Rheum. 48 (7), 2025-2035

Boraldi, F. et al. Hypoxia influences the cellular cross-talk of human dermal fibroblasts. A proteomic approach. Biochim. Biophys. Acta 1774, 1402-13 (2007). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 17904921

Braceland, M. et al. Serum enolase: a non-destructive biomarker of white skeletal myopathy during pancreas disease (PD) in Atlantic salmon Salmo salar L. J. Fish Dis. 38, 821-31 (2015). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 25168106

Deng, M. Y. et al. Frontal-subcortical protein expression following prenatal exposure to maternal inflammation. PLoS One 6, e16638 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21347362

Kitahashi, T., Yoshimoto, M. & Imai, T. Novel immunohistochemical marker, integrin -alpha(V)b(3), for BOP-induced early lesions in hamster pancreatic ductal carcinogenesis. Oncol. Lett. 2, 229-234 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22866069

Sørensen, B. S. et al. Proteins upregulated by mild and severe hypoxia in squamous cell carcinomas in vitro identified by proteomics. Radiother. Oncol. 92, 443-9 (2009). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 19541378

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...