Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34377_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34377_P050-FITC Conjugated

ARP34377_P050-HRP Conjugated

ARP34377_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100812 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ENO1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-ENO1 (ARP34377_P050)
Peptide Sequence Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ENO1 (ARP34377_P050) antibody is Catalog # AAP34377 (Previous Catalog # AAPY00219)
Datasheets/Manuals Printable datasheet for anti-ENO1 (ARP34377_P050) antibody
Target Reference Lee,K.H., et al., (2003) Arthritis Rheum. 48 (7), 2025-2035
Publications

Boraldi, F. et al. Hypoxia influences the cellular cross-talk of human dermal fibroblasts. A proteomic approach. Biochim. Biophys. Acta 1774, 1402-13 (2007). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 17904921

Braceland, M. et al. Serum enolase: a non-destructive biomarker of white skeletal myopathy during pancreas disease (PD) in Atlantic salmon Salmo salar L. J. Fish Dis. 38, 821-31 (2015). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 25168106

Deng, M. Y. et al. Frontal-subcortical protein expression following prenatal exposure to maternal inflammation. PLoS One 6, e16638 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21347362

Kitahashi, T., Yoshimoto, M. & Imai, T. Novel immunohistochemical marker, integrin -alpha(V)b(3), for BOP-induced early lesions in hamster pancreatic ductal carcinogenesis. Oncol. Lett. 2, 229-234 (2011). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22866069

Sørensen, B. S. et al. Proteins upregulated by mild and severe hypoxia in squamous cell carcinomas in vitro identified by proteomics. Radiother. Oncol. 92, 443-9 (2009). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 19541378

Gene Symbol ENO1
Official Gene Full Name Enolase 1, (alpha)
Alias Symbols NNE, PPH, MPB1, ENO1L1
NCBI Gene Id 2023
Protein Name Alpha-enolase
Description of Target ENO1 encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.
Swissprot Id Q53HR3
Protein Accession # NP_001419
Nucleotide Accession # NM_001428
Protein Size (# AA) 434
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ENO1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ENO1.
Protein Interactions UBC; FUS; HUWE1; ISG15; SUMO2; SUMO3; IVNS1ABP; STAU1; MDM2; WWOX; EED; FBXO6; UPF2; YWHAQ; UBD; TERT; SRC; RAD52; NPM1; BHLHE40; VCAM1; HCVgp1; ITGA4; FN1; ATF2; SERPING1; AMBP; LIG4; BRCA1; MDC1; PGK1; ITPA; GAPDH; FYN; FLNC; ENO3; Htt; TPI1; PPIA; AKT1
  1. What is the species homology for "ENO1 Antibody - middle region (ARP34377_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ENO1 Antibody - middle region (ARP34377_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ENO1 Antibody - middle region (ARP34377_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ENO1 Antibody - middle region (ARP34377_P050)"?

    This target may also be called "NNE, PPH, MPB1, ENO1L1" in publications.

  5. What is the shipping cost for "ENO1 Antibody - middle region (ARP34377_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ENO1 Antibody - middle region (ARP34377_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ENO1 Antibody - middle region (ARP34377_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ENO1 Antibody - middle region (ARP34377_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ENO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ENO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ENO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ENO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ENO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ENO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ENO1 Antibody - middle region (ARP34377_P050)
Your Rating
We found other products you might like!