- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-ENO1 (ARP34377_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ENO1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ENO1 (ARP34377_P050) antibody is Catalog # AAP34377 (Previous Catalog # AAPY00219) |
Reference | Lee,K.H., et al., (2003) Arthritis Rheum. 48 (7), 2025-2035 |
Publications | Boraldi, F. et al. Hypoxia influences the cellular cross-talk of human dermal fibroblasts. A proteomic approach. Biochim. Biophys. Acta 1774, 1402-13 (2007). 17904921 Braceland, M. et al. Serum enolase: a non-destructive biomarker of white skeletal myopathy during pancreas disease (PD) in Atlantic salmon Salmo salar L. J. Fish Dis. doi:10.1111/jfd.12296 (2014). 25168106 Deng, M. Y. et al. Frontal-subcortical protein expression following prenatal exposure to maternal inflammation. PLoS One 6, e16638 (2011). 21347362 Kitahashi, T., Yoshimoto, M. & Imai, T. Novel immunohistochemical marker, integrin a(V)beta(3), for BOP-induced early lesions in hamster pancreatic ductal carcinogenesis. Oncol. Lett. 2, 229-234 (2011). 22866069 Sørensen, B. S. et al. Proteins upregulated by mild and severe hypoxia in squamous cell carcinomas in vitro identified by proteomics. Radiother. Oncol. 92, 443-9 (2009). 19541378 |
Gene Symbol | ENO1 |
---|---|
Gene Full Name | Enolase 1, (alpha) |
Alias Symbols | NNE, PPH, MPB1, ENO1L1, HEL-S-17 |
NCBI Gene Id | 2023 |
Protein Name | Alpha-enolase |
Description of Target | ENO1 encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome. |
Uniprot ID | Q53HR3 |
Protein Accession # | NP_001419 |
Nucleotide Accession # | NM_001428 |
Protein Size (# AA) | 434 |
Molecular Weight | 47kDa |
Protein Interactions | UBC; FUS; HUWE1; ISG15; SUMO2; SUMO3; IVNS1ABP; STAU1; MDM2; WWOX; EED; FBXO6; UPF2; YWHAQ; UBD; TERT; SRC; RAD52; NPM1; BHLHE40; VCAM1; HCVgp1; ITGA4; FN1; ATF2; SERPING1; AMBP; LIG4; BRCA1; MDC1; PGK1; ITPA; GAPDH; FYN; FLNC; ENO3; Htt; TPI1; PPIA; AKT1 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ENO1 Antibody - middle region (ARP34377_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".
-
How long will it take to receive "ENO1 Antibody - middle region (ARP34377_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "ENO1 Antibody - middle region (ARP34377_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ENO1 Antibody - middle region (ARP34377_P050)"?
This target may also be called "NNE, PPH, MPB1, ENO1L1, HEL-S-17" in publications.
-
What is the shipping cost for "ENO1 Antibody - middle region (ARP34377_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ENO1 Antibody - middle region (ARP34377_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ENO1 Antibody - middle region (ARP34377_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "47kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ENO1 Antibody - middle region (ARP34377_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ENO1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ENO1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ENO1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ENO1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ENO1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ENO1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.