Catalog No: P100920_P050-HRP
Size:100ul
Price: $434.00
SKU
P100920_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-E2F5 (P100920_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human E2F5
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 84%
Peptide SequenceSynthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN
Concentration0.5 mg/ml
Blocking PeptideFor anti-E2F5 (P100920_P050-HRP) antibody is Catalog # AAP31273 (Previous Catalog # AAPP02022)
ReferenceOhtani,N., et al., (2003) J. Cell Biol. 162 (2), 173-183
Gene SymbolE2F5
Gene Full NameE2F transcription factor 5, p130-binding
Alias SymbolsE2F-5
NCBI Gene Id1875
Protein NameTranscription factor E2F5
Description of TargetE2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB.
Uniprot IDQ15329
Protein Accession #NP_001942
Nucleotide Accession #NM_001951
Protein Size (# AA)346
Molecular Weight38kDa
Protein InteractionsRBL2; UBC; KMT2D; BRCC3; SMAD3; EP300; XPO1; CREBBP; TFDP1; RBL1; BIRC5; MYC; MT1G;
  1. What is the species homology for "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    This target may also be called "E2F-5" in publications.

  5. What is the shipping cost for "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "E2F5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "E2F5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "E2F5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "E2F5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "E2F5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "E2F5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:E2F5 Antibody - N-terminal region : HRP (P100920_P050-HRP)
Your Rating