Search Antibody, Protein, and ELISA Kit Solutions

DDX10 Antibody - C-terminal region (ARP36369_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36369_P050-FITC Conjugated

ARP36369_P050-HRP Conjugated

ARP36369_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DDX10
Official Gene Full Name:
DEAD-box helicase 10
NCBI Gene Id:
1662
Protein Name:
probable ATP-dependent RNA helicase DDX10
Swissprot Id:
Q13206
Protein Accession #:
NP_004389
Nucleotide Accession #:
NM_004398.4
Alias Symbols:
HRH-J8
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies. 
Protein Size (# AA):
875
Molecular Weight:
96 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DDX10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DDX10.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX10
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-DDX10 (ARP36369_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; APP; CAND1; SIRT7; G3BP2; ERBB2;
Blocking Peptide:
For anti-DDX10 (ARP36369_P050) antibody is Catalog # AAP36369
Datasheets/Manuals:
Printable datasheet for anti-DDX10 (ARP36369_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...