SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36369_P050
Price: $0.00
SKU
ARP36369_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DDX10 Antibody - C-terminal region (ARP36369_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-DDX10 (ARP36369_P050) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DDX10
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE
Concentration0.5 mg/ml
Blocking PeptideFor anti-DDX10 (ARP36369_P050) antibody is Catalog # AAP36369
Gene SymbolDDX10
Gene Full NameDEAD-box helicase 10
Alias SymbolsDbp4, HRH-J8
NCBI Gene Id1662
Protein Nameprobable ATP-dependent RNA helicase DDX10
Description of TargetDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies. 
Uniprot IDQ13206
Protein Accession #NP_004389
Nucleotide Accession #NM_004398.4
Protein Size (# AA)875
Molecular Weight96 kDa
Protein InteractionsUBC; APP; CAND1; SIRT7; G3BP2; ERBB2;
  1. What is the species homology for "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "DDX10 Antibody - C-terminal region (ARP36369_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    This target may also be called "Dbp4, HRH-J8" in publications.

  5. What is the shipping cost for "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "96 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DDX10 Antibody - C-terminal region (ARP36369_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DDX10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DDX10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DDX10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DDX10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DDX10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DDX10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DDX10 Antibody - C-terminal region (ARP36369_P050)
Your Rating
We found other products you might like!