DDX10 Antibody : FITC (ARP36369_P050-FITC)

Catalog No: ARP36369_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: DDX10
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 10
• Alias Symbols: Dbp4, HRH-J8
• NCBI Gene Id: 1662
• Protein Name: Probable ATP-dependent RNA helicase DDX10
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies.
• Uniprot ID: Q13206
• Protein Accession #: NP_004389
• Nucleotide Accession #: NM_004398
• Protein Size (# AA): 875
• Molecular Weight: 101 kDa
• Protein Interactions: UBC; APP; CAND1; SIRT7; G3BP2; ERBB2;