| Product Number |
ARP36369_P050 |
| Product Page |
www.avivasysbio.com/ddx10-antibody-arp36369-p050.html |
| Name |
DDX10 Antibody - C-terminal region (ARP36369_P050) |
| Protein Size (# AA) |
875 amino acids |
| Molecular Weight |
96 kDa |
| NCBI Gene Id |
1662 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DEAD-box helicase 10 |
| Alias Symbols |
Dbp4, HRH-J8 |
| Peptide Sequence |
Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies. |
| Protein Interactions |
UBC; APP; CAND1; SIRT7; G3BP2; ERBB2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DDX10 (ARP36369_P050) antibody |
| Blocking Peptide |
For anti-DDX10 (ARP36369_P050) antibody is Catalog # AAP36369 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX10 |
| Uniprot ID |
Q13206 |
| Protein Name |
probable ATP-dependent RNA helicase DDX10 |
| Protein Accession # |
NP_004389 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_004398.4 |
| Gene Symbol |
DDX10 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: DDX10
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
