SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36369_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP36369_P050-HRP
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DDX10 Antibody : HRP (ARP36369_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-DDX10 (ARP36369_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolDDX10
Gene Full NameDEAD (Asp-Glu-Ala-Asp) box polypeptide 10
Alias SymbolsDbp4, HRH-J8
NCBI Gene Id1662
Protein NameProbable ATP-dependent RNA helicase DDX10
Description of TargetDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it may be involved in ribosome assembly. Fusion of this gene and the nucleoporin gene, NUP98, by inversion 11 (p15q22) chromosome translocation is found in the patients with de novo or therapy-related myeloid malignancies.
Uniprot IDQ13206
Protein Accession #NP_004389
Nucleotide Accession #NM_004398
Protein Size (# AA)875
Molecular Weight101 kDa
Protein InteractionsUBC; APP; CAND1; SIRT7; G3BP2; ERBB2;
  1. What is the species homology for "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Rabbit".

  2. How long will it take to receive "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "DDX10 Antibody : HRP (ARP36369_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    This target may also be called "Dbp4, HRH-J8" in publications.

  5. What is the shipping cost for "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "101 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DDX10 Antibody : HRP (ARP36369_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DDX10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DDX10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DDX10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DDX10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DDX10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DDX10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DDX10 Antibody : HRP (ARP36369_P050-HRP)
Your Rating
We found other products you might like!