Search Antibody, Protein, and ELISA Kit Solutions

DAPK3 Antibody - N-terminal region (ARP87991_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DAPK3
Official Gene Full Name:
death-associated protein kinase 3
NCBI Gene Id:
1613
Protein Name:
death-associated protein kinase 3
Swissprot Id:
O43293-2
Protein Accession #:
NP_001339.1
Nucleotide Accession #:
NM_001348.2
Alias Symbols:
DLK, ZIP, ZIPK
Description of Target:
Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis.
Protein Size (# AA):
322
Molecular Weight:
35 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IPO9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DAPK3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DAPK3 (ARP87991_P050) antibody is Catalog # AAP87991
Datasheets/Manuals:
Printable datasheet for anti-DAPK3 (ARP87991_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...