| Sku |
AAP87991 |
| Price |
99 |
| Name |
DAPK3 Peptide - N-terminal region (AAP87991) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
DAPK3 |
| Alias symbols |
DLK, ZIP, ZIPK |
| Gene id |
1613 |
| Description of target |
Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. |
| Swissprot id |
O43293-2 |
| Protein accession num |
NP_001339.1 |
| Nucleotide accession num |
NM_001348.2 |
| Protein size |
322 amino acids |
| Molecular weight |
35 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: EDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGV |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- DAPK3 Antibody (ARP80254_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
