| Product Number |
ARP87991_P050 |
| Product Page |
www.avivasysbio.com/dapk3-antibody-n-terminal-region-arp87991-p050.html |
| Name |
DAPK3 Antibody - N-terminal region (ARP87991_P050) |
| Protein Size (# AA) |
322 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
1613 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
death-associated protein kinase 3 |
| Alias Symbols |
DLK, ZIP, ZIPK |
| Peptide Sequence |
Synthetic peptide located within the following region: EDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DAPK3 (ARP87991_P050) antibody |
| Blocking Peptide |
For anti-DAPK3 (ARP87991_P050) antibody is Catalog # AAP87991 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK3 |
| Uniprot ID |
O43293-2 |
| Protein Name |
death-associated protein kinase 3 |
| Protein Accession # |
NP_001339.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001348.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DAPK3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: DAPK3
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
