Search Antibody, Protein, and ELISA Kit Solutions

CXCL12 Antibody - middle region (AVARP07031_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

AVARP07031_P050-FITC Conjugated

AVARP07031_P050-HRP Conjugated

AVARP07031_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Chemokine (C-X-C motif) ligand 12
NCBI Gene Id:
Protein Name:
Stromal cell-derived factor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133989 from Santa Cruz Biotechnology.
Description of Target:
Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF, or IL1. The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CXCL12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CXCL12.
The immunogen is a synthetic peptide directed towards the middle region of human CXCL12
Predicted Homology Based on Immunogen Sequence:
Cow: 90%; Dog: 100%; Pig: 100%; Rat: 90%
Complete computational species homology data:
Anti-CXCL12 (AVARP07031_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CXCL12 (AVARP07031_P050) antibody is Catalog # AAP30814 (Previous Catalog # AAPP01478)
Printable datasheet for anti-CXCL12 (AVARP07031_P050) antibody
Target Reference:
Sadir,R., et al., (2004) J. Biol. Chem. 279 (42), 43854-43860

Yin, J. & Seeberger, P. H. Applications of heparin and heparan sulfate microarrays. Methods Enzymol. 478, 197-218 (2010). WB, Cow, Dog, Pig, Rat 20816481

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...