Catalog No: AVARP07031_P050
Price: $0.00
SKU
AVARP07031_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CXCL12 (AVARP07031_P050) antibody
Product Info
ReferenceSadir,R., et al., (2004) J. Biol. Chem. 279 (42), 43854-43860
Publications

Biopolymer-delivered vascular endothelial growth factor improves renal outcomes following revascularization. Am J Physiol Renal Physiol. 316, F1016-F1025 (2019). 30892933

Yin, J. & Seeberger, P. H. Applications of heparin and heparan sulfate microarrays. Methods Enzymol. 478, 197-218 (2010). 20816481

Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityRat, Cow, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CXCL12
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 90%; Dog: 100%; Pig: 100%; Rat: 90%
Peptide SequenceSynthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Concentration0.5 mg/ml
Blocking PeptideFor anti-CXCL12 (AVARP07031_P050) antibody is Catalog # AAP30814 (Previous Catalog # AAPP01478)
Enhanced Validation
WBY
SPR
YCHAROS
Gene SymbolCXCL12
Gene Full NameChemokine (C-X-C motif) ligand 12
Alias SymbolsIRH, PBSF, SDF1, TLSF, TPAR1, SCYB12
NCBI Gene Id6387
Protein NameStromal cell-derived factor 1
Description of TargetStromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF, or IL1. The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.
Uniprot IDP48061
Protein Accession #NP_000600
Nucleotide Accession #NM_000609
Protein Size (# AA)93
Molecular Weight11 kDa
Protein InteractionsDAZAP2; CXCR4; CXCL12; DPP4; CD4; FN1; ELANE; MMP2; CTSG; VCAN; PF4;
  1. What is the species homology for "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Rat, Cow, Dog, Pig".

  2. How long will it take to receive "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CXCL12 Antibody - middle region (AVARP07031_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    This target may also be called "IRH, PBSF, SDF1, TLSF, TPAR1, SCYB12" in publications.

  5. What is the shipping cost for "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CXCL12 Antibody - middle region (AVARP07031_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CXCL12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CXCL12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CXCL12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CXCL12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CXCL12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CXCL12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CXCL12 Antibody - middle region (AVARP07031_P050)
Your Rating
We found other products you might like!