Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
AVARP07031_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP07031_P050-FITC Conjugated

AVARP07031_P050-HRP Conjugated

AVARP07031_P050-Biotin Conjugated

CXCL12 Antibody - middle region (AVARP07031_P050)

Catalog#: AVARP07031_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133989 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL12
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 90%; Dog: 100%; Pig: 100%; Rat: 90%
Complete computational species homology data Anti-CXCL12 (AVARP07031_P050)
Peptide Sequence Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CXCL12 (AVARP07031_P050) antibody is Catalog # AAP30814 (Previous Catalog # AAPP01478)
Datasheets/Manuals Printable datasheet for anti-CXCL12 (AVARP07031_P050) antibody
Target Reference Sadir,R., et al., (2004) J. Biol. Chem. 279 (42), 43854-43860
Publications

Yin, J. & Seeberger, P. H. Applications of heparin and heparan sulfate microarrays. Methods Enzymol. 478, 197-218 (2010). WB, Cow, Dog, Pig, Rat 20816481

Gene Symbol CXCL12
Official Gene Full Name Chemokine (C-X-C motif) ligand 12
Alias Symbols IRH, PBSF, SDF1, TLSF, SDF1A, SDF1B, TPAR1, SCYB12
NCBI Gene Id 6387
Protein Name Stromal cell-derived factor 1
Description of Target Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF, or IL1. The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.
Swissprot Id P48061
Protein Accession # NP_000600
Nucleotide Accession # NM_000609
Protein Size (# AA) 93
Molecular Weight 11kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CXCL12.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CXCL12.
Protein Interactions DAZAP2; CXCR4; CXCL12; DPP4; CD4; FN1; ELANE; MMP2; CTSG; VCAN; PF4;
Write Your Own Review
You're reviewing:CXCL12 Antibody - middle region (AVARP07031_P050)
Your Rating