Product Number |
AVARP07031_P050 |
Product Page |
www.avivasysbio.com/cxcl12-antibody-middle-region-avarp07031-p050.html |
Name |
CXCL12 Antibody - middle region (AVARP07031_P050) |
Protein Size (# AA) |
93 amino acids |
Molecular Weight |
11 kDa |
NCBI Gene Id |
6387 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chemokine (C-X-C motif) ligand 12 |
Description |
|
Alias Symbols |
IRH, PBSF, SDF1, TLSF, TPAR1, SCYB12 |
Peptide Sequence |
Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sadir,R., et al., (2004) J. Biol. Chem. 279 (42), 43854-43860 |
Description of Target |
Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF, or IL1. The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group. |
Protein Interactions |
DAZAP2; CXCR4; CXCL12; DPP4; CD4; FN1; ELANE; MMP2; CTSG; VCAN; PF4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-CXCL12 (AVARP07031_P050) antibody |
Blocking Peptide |
For anti-CXCL12 (AVARP07031_P050) antibody is Catalog # AAP30814 (Previous Catalog # AAPP01478) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CXCL12 |
Uniprot ID |
P48061 |
Protein Name |
Stromal cell-derived factor 1 |
Publications |
Biopolymer-delivered vascular endothelial growth factor improves renal outcomes following revascularization. Am J Physiol Renal Physiol. 316, F1016-F1025 (2019). 30892933
Yin, J. & Seeberger, P. H. Applications of heparin and heparan sulfate microarrays. Methods Enzymol. 478, 197-218 (2010). 20816481 |
Protein Accession # |
NP_000600 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000609 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
CXCL12 |
Predicted Species Reactivity |
Rat, Cow, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 90%; Dog: 100%; Pig: 100%; Rat: 90% |
Image 1 | Human Lung
| WB Suggested Anti-CXCL12 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Lung |
|
Image 2 | Mouse Pancreas
| Host: Mouse Target Name: CXCL12 Sample Tissue: Mouse Pancreas Antibody Dilution: 1ug/ml |
|