CXCL12 Antibody - middle region (AVARP07031_P050)

Data Sheet
 
Product Number AVARP07031_P050
Product Page www.avivasysbio.com/cxcl12-antibody-middle-region-avarp07031-p050.html
Name CXCL12 Antibody - middle region (AVARP07031_P050)
Protein Size (# AA) 93 amino acids
Molecular Weight 11 kDa
NCBI Gene Id 6387
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chemokine (C-X-C motif) ligand 12
Description
Alias Symbols IRH, PBSF, SDF1, TLSF, TPAR1, SCYB12
Peptide Sequence Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sadir,R., et al., (2004) J. Biol. Chem. 279 (42), 43854-43860
Description of Target Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF, or IL1. The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.
Protein Interactions DAZAP2; CXCR4; CXCL12; DPP4; CD4; FN1; ELANE; MMP2; CTSG; VCAN; PF4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-CXCL12 (AVARP07031_P050) antibody
Blocking Peptide For anti-CXCL12 (AVARP07031_P050) antibody is Catalog # AAP30814 (Previous Catalog # AAPP01478)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL12
Uniprot ID P48061
Protein Name Stromal cell-derived factor 1
Publications

Biopolymer-delivered vascular endothelial growth factor improves renal outcomes following revascularization. Am J Physiol Renal Physiol. 316, F1016-F1025 (2019). 30892933

Yin, J. & Seeberger, P. H. Applications of heparin and heparan sulfate microarrays. Methods Enzymol. 478, 197-218 (2010). 20816481

Protein Accession # NP_000600
Purification Affinity Purified
Nucleotide Accession # NM_000609
Tested Species Reactivity Human, Mouse
Gene Symbol CXCL12
Predicted Species Reactivity Rat, Cow, Dog, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 90%; Dog: 100%; Pig: 100%; Rat: 90%
Image 1
Human Lung
WB Suggested Anti-CXCL12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung
Image 2
Mouse Pancreas
Host: Mouse
Target Name: CXCL12
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com