CXCL12 Protein (OPCB00002)

Catalog No: OPCB00002

Size:5ug

Migration Assay: Jurkat cells expressing endogenous CXCR4 were assayed for migration through a transwell filter at various concentrations of WT SDF-1 alpha. Responses are expressed as the % of total input cells

Product Info

• Product Format: Lyophilized
• Application: CA
• Additional Information: Extinction Coefficient: 8730 M-1 cm-1
  Endotoxin Level: <0.01 EU per 1ug of the protein by the LAL method
• Reconstitution and Storage: Store for 12 months from date of receipt; -20°C to -70°C as supplied. Spin tube prior to resuspending. Recommended at 100 ug/mL in sterile water. Use immediately after reconstitution. Store for 1 month at -20°C to -70°C under sterile conditions after reconstitution. Avoid repeated freeze/thaw cycles.
• Purity: > 97% as determined by SDS-PAGE
• Biological Activity: EC50 = 0.62nM determined by Calcium Flux with human CXCR4 in U937 cells
• Protein Sequence: The protein sequence is: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
• Source: E. coli
• Reference: 1. "Structure and chromosomal localization of the human stromal cell-derived factor 1 (SDF1) gene."
  Shirozu M., Nakano T., Inazawa J., Tashiro K., Tada H., Shinohara T., Honjo T.
  Genomics 28:495-500(1995)
  2. "Identification and expression of novel isoforms of human stromal cell-derived factor 1."
  Yu L., Cecil J., Peng S.B., Schrementi J., Kovacevic S., Paul D., Su E.W., Wang J.
  Gene 374:174-179(2006)
  3. "Nucleotide sequence of hIRH, human intercrine reduced in hepatomas."
  Begum N.A., Barnard G.F.
  Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases
  4. "Polymorphism study of cell-derived factor 1 (SDF1) gene and their correlation with HIV infection in a Chinese cohort."
  Zhao X., Zhang H., Lee S., Wong K., Zheng B.
  Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases

Target Info

• Gene Symbol: CXCL12
• Gene Full Name: chemokine (C-X-C motif) ligand 12
• Alias Symbols: IRH, PBSF, SDF1, TLSF, TPAR1, SCYB12
• NCBI Gene Id: 6387
• Description of Target: Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.
• Uniprot ID: P48061
• Molecular Weight: 7.959 kDa