Catalog No: OPCB00002
Size:2ug
Price: $82.00
SKU
OPCB00002
Availability: Domestic: within 1-2 week delivery | International: within 1-2 week delivery
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPCB00002 |
---|
Product Format | Lyophilized |
---|---|
Application | CA |
Additional Information | Extinction Coefficient: 8730 M-1 cm-1 Endotoxin Level: <0.01 EU per 1ug of the protein by the LAL method |
Reconstitution and Storage | Store for 12 months from date of receipt; -20°C to -70°C as supplied. Spin tube prior to resuspending. Recommended at 100 ug/mL in sterile water. Use immediately after reconstitution. Store for 1 month at -20°C to -70°C under sterile conditions after reconstitution. Avoid repeated freeze/thaw cycles. |
Purity | > 97% as determined by SDS-PAGE |
Biological Activity | EC50 = 0.62nM determined by Calcium Flux with human CXCR4 in U937 cells |
Protein Sequence | The protein sequence is: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
Source | E. coli |
Reference | 1. "Structure and chromosomal localization of the human stromal cell-derived factor 1 (SDF1) gene." Shirozu M., Nakano T., Inazawa J., Tashiro K., Tada H., Shinohara T., Honjo T. Genomics 28:495-500(1995) 2. "Identification and expression of novel isoforms of human stromal cell-derived factor 1." Yu L., Cecil J., Peng S.B., Schrementi J., Kovacevic S., Paul D., Su E.W., Wang J. Gene 374:174-179(2006) 3. "Nucleotide sequence of hIRH, human intercrine reduced in hepatomas." Begum N.A., Barnard G.F. Submitted (JAN-1995) to the EMBL/GenBank/DDBJ databases 4. "Polymorphism study of cell-derived factor 1 (SDF1) gene and their correlation with HIV infection in a Chinese cohort." Zhao X., Zhang H., Lee S., Wong K., Zheng B. Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases |
Gene Symbol | CXCL12 |
---|---|
Gene Full Name | chemokine (C-X-C motif) ligand 12 |
Alias Symbols | IRH, PBSF, SDF1, TLSF, TPAR1, SCYB12 |
NCBI Gene Id | 6387 |
Description of Target | Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. |
Uniprot ID | P48061 |
Molecular Weight | 7.959 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!