Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
SKU
ARP34673_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34673_T100-FITC Conjugated

ARP34673_T100-HRP Conjugated

ARP34673_T100-Biotin Conjugated

CREB3L2 Antibody - N-terminal region (ARP34673_T100)

Catalog#: ARP34673_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-133483 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
Complete computational species homology dataAnti-CREB3L2 (ARP34673_T100)
Peptide SequenceSynthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CREB3L2 (ARP34673_T100) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
Datasheets/ManualsPrintable datasheet for anti-CREB3L2 (ARP34673_T100) antibody
Target ReferenceStorlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
Publications

Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21041443

Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22682248

Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19016743

Gene SymbolCREB3L2
Official Gene Full NameCAMP responsive element binding protein 3-like 2
Alias SymbolsBBF2H7
NCBI Gene Id64764
Protein NameCyclic AMP-responsive element-binding protein 3-like protein 2
Description of TargetCREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
Swissprot IdQ70SY1
Protein Accession #NP_919047
Nucleotide Accession #NM_194071
Protein Size (# AA)520
Molecular Weight57kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CREB3L2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CREB3L2.
Protein InteractionsFbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
Write Your Own Review
You're reviewing:CREB3L2 Antibody - N-terminal region (ARP34673_T100)
Your Rating
Aviva Blast Tool
Aviva HIS tag Deal
Free Microscope
Aviva Validation Data