Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP34673_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34673_T100-FITC Conjugated

ARP34673_T100-HRP Conjugated

ARP34673_T100-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133483 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
Complete computational species homology data Anti-CREB3L2 (ARP34673_T100)
Peptide Sequence Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CREB3L2 (ARP34673_T100) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
Datasheets/Manuals Printable datasheet for anti-CREB3L2 (ARP34673_T100) antibody
Target Reference Storlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
Publications

Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21041443

Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22682248

Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19016743

Gene Symbol CREB3L2
Official Gene Full Name CAMP responsive element binding protein 3-like 2
Alias Symbols BBF2H7
NCBI Gene Id 64764
Protein Name Cyclic AMP-responsive element-binding protein 3-like protein 2
Description of Target CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
Swissprot Id Q70SY1
Protein Accession # NP_919047
Nucleotide Accession # NM_194071
Protein Size (# AA) 520
Molecular Weight 57kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CREB3L2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CREB3L2.
Protein Interactions Fbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
  1. What is the species homology for "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CREB3L2 Antibody - N-terminal region (ARP34673_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    This target may also be called "BBF2H7" in publications.

  5. What is the shipping cost for "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CREB3L2 Antibody - N-terminal region (ARP34673_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CREB3L2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CREB3L2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CREB3L2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CREB3L2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CREB3L2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CREB3L2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CREB3L2 Antibody - N-terminal region (ARP34673_T100)
Your Rating
We found other products you might like!