Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CREB3L2 antibody - N-terminal region (ARP34673_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP34673_T100-FITC Conjugated

ARP34673_T100-HRP Conjugated

ARP34673_T100-Biotin Conjugated

Gene Symbol:
CREB3L2
NCBI Gene Id:
64764
Official Gene Full Name:
CAMP responsive element binding protein 3-like 2
Protein Name:
Cyclic AMP-responsive element-binding protein 3-like protein 2
Swissprot Id:
Q70SY1
Protein Accession #:
NP_919047
Nucleotide Accession #:
NM_194071
Alias Symbols:
BBF2H7
Replacement Item:
This antibody may replace item sc-133483 from Santa Cruz Biotechnology.
Description of Target:
CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
Protein Size (# AA):
520
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CREB3L2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CREB3L2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
Complete computational species homology data:
Anti-CREB3L2 (ARP34673_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Fbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
Blocking Peptide:
For anti-CREB3L2 (ARP34673_T100) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
Datasheets/Manuals:
Printable datasheet for anti-CREB3L2 (ARP34673_T100) antibody
Target Reference:
Storlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
Publications:

Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19016743

Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21041443

Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22682248

Tell us what you think about this item!

Write A Review
    Please, wait...