Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34673_T100 Unconjugated

ARP34673_T100-HRP Conjugated

ARP34673_T100-Biotin Conjugated

Gene Symbol:
CREB3L2
Official Gene Full Name:
CAMP responsive element binding protein 3-like 2
NCBI Gene Id:
64764
Protein Name:
Cyclic AMP-responsive element-binding protein 3-like protein 2
Swissprot Id:
Q70SY1
Protein Accession #:
NP_919047
Nucleotide Accession #:
NM_194071
Alias Symbols:
BBF2H7
Replacement Item:
This antibody may replace item sc-133483 from Santa Cruz Biotechnology.
Description of Target:
CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
Protein Size (# AA):
520
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CREB3L2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CREB3L2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
Complete computational species homology data:
Anti-CREB3L2 (ARP34673_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
Fbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
Blocking Peptide:
For anti-CREB3L2 (ARP34673_T100-FITC) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
Datasheets/Manuals:
Printable datasheet for anti-CREB3L2 (ARP34673_T100-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Storlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
Publications:

Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). WB, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 19016743

Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). ICC/IF, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 21041443

Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). WB, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 22682248

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...