SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP34673_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP34673_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-CREB3L2 (ARP34673_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
Peptide SequenceSynthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
Concentration0.5 mg/ml
Blocking PeptideFor anti-CREB3L2 (ARP34673_T100-FITC) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
ReferenceStorlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
Publications

Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). WB, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 19016743

Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). ICC/IF, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 21041443

Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). WB, Human, Bovine, Horse, Rabbit, Rat, Guinea pig, Mouse, Dog 22682248

Gene SymbolCREB3L2
Gene Full NameCAMP responsive element binding protein 3-like 2
Alias SymbolsBBF2H7
NCBI Gene Id64764
Protein NameCyclic AMP-responsive element-binding protein 3-like protein 2
Description of TargetCREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
Uniprot IDQ70SY1
Protein Accession #NP_919047
Nucleotide Accession #NM_194071
Protein Size (# AA)520
Molecular Weight57kDa
Protein InteractionsFbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
  1. What is the species homology for "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    This target may also be called "BBF2H7" in publications.

  5. What is the shipping cost for "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CREB3L2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CREB3L2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CREB3L2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CREB3L2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CREB3L2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CREB3L2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CREB3L2 Antibody - N-terminal region : FITC (ARP34673_T100-FITC)
Your Rating
We found other products you might like!