CREB3L2 Antibody - N-terminal region (ARP34673_T100)

• Product Number: ARP34673_T100
• Name: CREB3L2 Antibody - N-terminal region (ARP34673_T100)
• Protein Size (# AA): 520 amino acids
• Molecular Weight: 57 kDa
• NCBI Gene Id: 64764
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: CAMP responsive element binding protein 3-like 2
• Description:
  View product citations for CREB3L2 Antibody - N-terminal region (ARP34673_T100) on CiteAb
• Alias Symbols: BBF2H7
• Peptide Sequence: Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Storlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358
• Description of Target: CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).
• Protein Interactions: Fbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-CREB3L2 (ARP34673_T100) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2
• Uniprot ID: Q70SY1
• Protein Name: Cyclic AMP-responsive element-binding protein 3-like protein 2
• Publications:

  CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. J Cell Sci. 130, 4155-4167 (2017). 29093023

  Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). 21041443

  Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). 22682248

  Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). 19016743

• Protein Accession #: NP_919047
• Purification: Protein A purified
• Nucleotide Accession #: NM_194071
• Tested Species Reactivity: Human
• Gene Symbol: CREB3L2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CREB3L2 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:12500
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: CREB3L2
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Lung
  
  Host: Rabbit
  Target Name: CREB3L2
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Fetal Heart
  
  Host: Rabbit
  Target Name: CREB3L2
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 6: Human Fetal Brain
  
  Host: Rabbit
  Target Name: CREB3L2
  Sample Type: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml