Size:100 ul
$319.00
In stock
SKU
ARP44796_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44796_P050-FITC Conjugated

ARP44796_P050-HRP Conjugated

ARP44796_P050-Biotin Conjugated

More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-20514 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CPT1A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-CPT1A (ARP44796_P050)
Peptide SequenceSynthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CPT1A (ARP44796_P050) antibody is Catalog # AAP44796 (Previous Catalog # AAPP12272)
Datasheets/ManualsPrintable datasheet for anti-CPT1A (ARP44796_P050) antibody
Target ReferenceRoomets,E., (2008) Invest. Ophthalmol. Vis. Sci. 49 (4), 1660-1664
Publications

Convertini, P; Menga, A; Andria, G; Scala, I; Santarsiero, A; Castiglione Morelli, MA; Iacobazzi, V; Infantino, V; The contribution of the citrate pathway to oxidative stress in Down syndrome. 149, 423-431 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27502741

Laghezza, A. et al. New 2-(aryloxy)-3-phenylpropanoic acids as peroxisome proliferator-activated receptor -alpha/γ dual agonists able to upregulate mitochondrial carnitine shuttle system gene expression. J. Med. Chem. 56, 60-72 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23171045

Piemontese, L; Cerchia, C; Laghezza, A; Ziccardi, P; Sblano, S; Tortorella, P; Iacobazzi, V; Infantino, V; Convertini, P; Dal Piaz, F; Lupo, A; Colantuoni, V; Lavecchia, A; Loiodice, F; New diphenylmethane derivatives as peroxisome proliferator-activated receptor alpha/gamma dual agonists endowed with anti-proliferative effects and mitochondrial activity. 127, 379-397 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 28076827

Gene SymbolCPT1A
Official Gene Full NameCarnitine palmitoyltransferase 1A (liver)
Alias SymbolsCPT1, CPT1-L, L-CPT1
NCBI Gene Id1374
Protein NameCarnitine O-palmitoyltransferase 1, liver isoform
Description of TargetThe mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Swissprot IdP50416
Protein Accession #NP_001027017
Nucleotide Accession #NM_001031847
Protein Size (# AA)756
Molecular Weight86kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CPT1A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CPT1A.
Protein InteractionsUBC; SUMO2; LGR4; RNF2; FBXO6; PARK2; LYN; CLN3; HDAC11; KBTBD7; NPDC1; HSPA5; NR4A1; CYBA; CLIC1; SNRNP200; ERLIN1; TOMM40; EIF3C; PCBP1; NDUFV1; NDUFS1; NDUFA2; LPP; CPS1; ATP6V1C1; RHOA; PCK1; BCL2;
Write Your Own Review
You're reviewing:CPT1A Antibody - middle region (ARP44796_P050)
Your Rating
Aviva Pathways
Aviva HIS tag Deal
Aviva Travel Grant
Aviva Tips and Tricks