Catalog No: ARP44796_P050
Price: $0.00
SKU
ARP44796_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CPT1A (ARP44796_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CPT1A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN
Concentration0.5 mg/ml
Blocking PeptideFor anti-CPT1A (ARP44796_P050) antibody is Catalog # AAP44796 (Previous Catalog # AAPP12272)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceRoomets,E., (2008) Invest. Ophthalmol. Vis. Sci. 49 (4), 1660-1664
Publications

Laghezza, A. et al. New 2-(aryloxy)-3-phenylpropanoic acids as peroxisome proliferator-activated receptor a/γ dual agonists able to upregulate mitochondrial carnitine shuttle system gene expression. J. Med. Chem. 56, 60-72 (2013). 23171045

New diphenylmethane derivatives as peroxisome proliferator-activated receptor alpha/gamma dual agonists endowed with anti-proliferative effects and mitochondrial activity. Eur J Med Chem. 127, 379-397 (2017). 28076827

Silibinin improves nonalcoholic fatty liver by regulating the expression of miR‑122: An in vitro and in vivo study. Mol Med Rep. 23 (2021) 33760189

The contribution of the citrate pathway to oxidative stress in Down syndrome. Immunology. 149, 423-431 (2016). 27502741

The role of CD36-Fabp4-PPARγ in skeletal muscle involves insulin resistance in intrauterine growth retardation mice with catch-up growth. BMC Endocr Disord. 22, 10 (2022). 34983495

Gene SymbolCPT1A
Gene Full NameCarnitine palmitoyltransferase 1A (liver)
Alias SymbolsCPT1, CPT1-L, L-CPT1
NCBI Gene Id1374
Protein NameCarnitine O-palmitoyltransferase 1, liver isoform
Description of TargetThe mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP50416
Protein Accession #NP_001027017
Nucleotide Accession #NM_001031847
Protein Size (# AA)756
Molecular Weight88 kDa
Protein InteractionsUBC; SUMO2; LGR4; RNF2; FBXO6; PARK2; LYN; CLN3; HDAC11; KBTBD7; NPDC1; HSPA5; NR4A1; CYBA; CLIC1; SNRNP200; ERLIN1; TOMM40; EIF3C; PCBP1; NDUFV1; NDUFS1; NDUFA2; LPP; CPS1; ATP6V1C1; RHOA; PCK1; BCL2;
  1. What is the species homology for "CPT1A Antibody - middle region (ARP44796_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "CPT1A Antibody - middle region (ARP44796_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CPT1A Antibody - middle region (ARP44796_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CPT1A Antibody - middle region (ARP44796_P050)"?

    This target may also be called "CPT1, CPT1-L, L-CPT1" in publications.

  5. What is the shipping cost for "CPT1A Antibody - middle region (ARP44796_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CPT1A Antibody - middle region (ARP44796_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CPT1A Antibody - middle region (ARP44796_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "88 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CPT1A Antibody - middle region (ARP44796_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CPT1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CPT1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CPT1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CPT1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CPT1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CPT1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CPT1A Antibody - middle region (ARP44796_P050)
Your Rating
We found other products you might like!