Search Antibody, Protein, and ELISA Kit Solutions

COPA antibody - N-terminal region (ARP51893_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51893_P050-FITC Conjugated

ARP51893_P050-HRP Conjugated

ARP51893_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Coatomer protein complex, subunit alpha
Protein Name:
Coatomer subunit alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133474 from Santa Cruz Biotechnology.
Description of Target:
In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COPA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COPA.
The immunogen is a synthetic peptide directed towards the N terminal region of human COPA
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Complete computational species homology data:
Anti-COPA (ARP51893_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-COPA (ARP51893_P050) antibody is Catalog # AAP51893 (Previous Catalog # AAPP40072)
Printable datasheet for anti-COPA (ARP51893_P050) antibody
Sample Type Confirmation:

COPA is strongly supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Ting, C.-H. et al. The spinal muscular atrophy disease protein SMN is linked to the Golgi network. PLoS One 7, e51826 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23284781

Li, H; Custer, SK; Gilson, T; Hao, le T; Beattie, CE; Androphy, EJ; α-COP binding to the survival motor neuron protein SMN is required for neuronal process outgrowth. 24, 7295-307 (2015). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26464491

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...