Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP51893_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51893_P050-FITC Conjugated

ARP51893_P050-HRP Conjugated

ARP51893_P050-Biotin Conjugated

COPA Antibody - N-terminal region (ARP51893_P050)

Catalog#: ARP51893_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133474 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COPA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Complete computational species homology data Anti-COPA (ARP51893_P050)
Peptide Sequence Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COPA (ARP51893_P050) antibody is Catalog # AAP51893 (Previous Catalog # AAPP40072)
Datasheets/Manuals Printable datasheet for anti-COPA (ARP51893_P050) antibody
Sample Type Confirmation

COPA is strongly supported by BioGPS gene expression data to be expressed in HeLa

Subunit alpha
Target Reference Olsen,J.V., (2006) Cell 127 (3), 635-648
Publications

Li, H; Custer, SK; Gilson, T; Hao, le T; Beattie, CE; Androphy, EJ; α-COP binding to the survival motor neuron protein SMN is required for neuronal process outgrowth. 24, 7295-307 (2015). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26464491

Ting, C.-H. et al. The spinal muscular atrophy disease protein SMN is linked to the Golgi network. PLoS One 7, e51826 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23284781

Gene Symbol COPA
Official Gene Full Name Coatomer protein complex, subunit alpha
Alias Symbols FLJ26320, HEP-COP
NCBI Gene Id 1314
Protein Name Coatomer subunit alpha
Description of Target In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms.
Swissprot Id P53621
Protein Accession # NP_004362
Nucleotide Accession # NM_004371
Protein Size (# AA) 1224
Molecular Weight 135kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COPA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COPA.
Protein Interactions UBC; SUMO2; SMN1; STAU1; NUDCD1; SUMO1; NEDD8; RPA3; RPA2; RPA1; SUZ12; RNF2; COPZ1; DHX38; COPB2; CCT3; TCP1; SEPT2; ARCN1; UBD; VCAM1; ITGA4; COPB1; COPG2; COPG1; COPE; SEPT9; SEC23A; SEC24C; UBXN6; FBXO6; LMAN1; SACM1L; DDX20; TMED10; GEMIN2; COPA; CDK
Write Your Own Review
You're reviewing:COPA Antibody - N-terminal region (ARP51893_P050)
Your Rating