Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

COPA Antibody - middle region (ARP51894_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51894_P050-FITC Conjugated

ARP51894_P050-HRP Conjugated

ARP51894_P050-Biotin Conjugated

Gene Symbol:
COPA
Official Gene Full Name:
Coatomer protein complex, subunit alpha
NCBI Gene Id:
1314
Protein Name:
Coatomer subunit alpha
Swissprot Id:
P53621
Protein Accession #:
NP_004362
Nucleotide Accession #:
NM_004371
Alias Symbols:
FLJ26320, HEP-COP
Replacement Item:
This antibody may replace item sc-133474 from Santa Cruz Biotechnology.
Description of Target:
In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms.In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms.
Protein Size (# AA):
1224
Molecular Weight:
135kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COPA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COPA.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human COPA
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-COPA (ARP51894_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO2; SMN1; STAU1; NUDCD1; SUMO1; NEDD8; RPA3; RPA2; RPA1; SUZ12; RNF2; COPZ1; DHX38; COPB2; CCT3; TCP1; SEPT2; ARCN1; UBD; VCAM1; ITGA4; COPB1; COPG2; COPG1; COPE; SEPT9; SEC23A; SEC24C; UBXN6; FBXO6; LMAN1; SACM1L; DDX20; TMED10; GEMIN2; COPA; CDK
Blocking Peptide:
For anti-COPA (ARP51894_P050) antibody is Catalog # AAP51894 (Previous Catalog # AAPY03575)
Datasheets/Manuals:
Printable datasheet for anti-COPA (ARP51894_P050) antibody
Sample Type Confirmation:

COPA is strongly supported by BioGPS gene expression data to be expressed in 721_B

Subunit:
alpha
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 02:58
  • Overall Experience:
  • Quality:
HeLa cells in IF

Submitted by:
Dr. Dan Levy, Richik Nilay Mukherjee
University of Wyoming

COPA

1. Species and tissue/cell type used: HeLa cells

2. Fixation method: PFA

3. Antigen retrieval method: None

4. Primary antibody dilution: 1:100, 1:400.

5. Secondary antibody and dilution: Goat anti-Rabbit Alexa Fluor 568; 1:400.

6. Stain/counterstain: Hoechst

8. Protocol:
Wash cells grown on coverslips 3x with PBS. Fix with 4% PFA (in PBS) 15 min Room Temp. Wash 3x with PBS, 5min each. Permeabilize cells with 0.1- 0.25% Triton-X-100 (in PBS) for 10min. Wash 3x with PBS, 5min each. Block 1hr at RT with 10% Goat Serum (all our secondary antibodies are produced in goat) + 0.3M Glycine. Incubate overnight at 4C with primary antibody (in 5% goat serum). Wash 3x in PBS, 5min each. Incubate with secondary antibodies (1:300) & Hoechst (1:1000) dissolved in 5% Goat serum at RT, 1hr. Wash 3x PBS, 5min each. Wash 2x with dH2O briefly. Dry and mount in mounting medium.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...