Search Antibody, Protein, and ELISA Kit Solutions

CGAS Antibody - middle region (ARP52607_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52607_P050-FITC Conjugated

ARP52607_P050-HRP Conjugated

ARP52607_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CGAS
Official Gene Full Name:
cyclic GMP-AMP synthase
NCBI Gene Id:
115004
Protein Name:
cyclic GMP-AMP synthase
Swissprot Id:
Q8N884
Protein Accession #:
NP_612450
Nucleotide Accession #:
NM_138441
Alias Symbols:
MB21D1, h-cGAS, C6orf150
Protein Size (# AA):
522
Molecular Weight:
59kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CGAS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CGAS.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human C6orf150
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Pig, Rabbit
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100%
Complete computational species homology data:
Anti-C6orf150 (ARP52607_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; ELAVL1;
Blocking Peptide:
For anti-CGAS (ARP52607_P050) antibody is Catalog # AAP52607 (Previous Catalog # AAPY03686)
Datasheets/Manuals:
Printable datasheet for anti-CGAS (ARP52607_P050) antibody
Target Reference:
Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101
Publications:

Schoggins, J. W. et al. A diverse range of gene products are effectors of the type I interferon antiviral response. Nature 472, 481-5 (2011). WB, Cow, Guinea Pig, Horse, Human, Pig, Rabbit 21478870

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...