Search Antibody, Protein, and ELISA Kit Solutions

CGAS Antibody - middle region (ARP52607_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52607_P050-FITC Conjugated

ARP52607_P050-HRP Conjugated

ARP52607_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
cyclic GMP-AMP synthase
Protein Name:
cyclic GMP-AMP synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MB21D1, h-cGAS, C6orf150
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CGAS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CGAS.
The immunogen is a synthetic peptide directed towards the middle region of human C6orf150
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100%
Complete computational species homology data:
Anti-C6orf150 (ARP52607_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CGAS (ARP52607_P050) antibody is Catalog # AAP52607 (Previous Catalog # AAPY03686)
Printable datasheet for anti-CGAS (ARP52607_P050) antibody
Target Reference:
Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Schoggins, J. W. et al. A diverse range of gene products are effectors of the type I interferon antiviral response. Nature 472, 481-5 (2011). WB, Cow, Guinea Pig, Horse, Human, Pig, Rabbit 21478870

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...