Product Number |
ARP52607_P050 |
Product Page |
www.avivasysbio.com/cgas-antibody-middle-region-arp52607-p050.html |
Name |
CGAS Antibody - middle region (ARP52607_P050) |
Protein Size (# AA) |
522 amino acids |
Molecular Weight |
59kDa |
NCBI Gene Id |
115004 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
cyclic GMP-AMP synthase |
Alias Symbols |
MB21D1, h-cGAS, C6orf150 |
Peptide Sequence |
Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101 |
Protein Interactions |
UBC; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CGAS (ARP52607_P050) antibody |
Blocking Peptide |
For anti-CGAS (ARP52607_P050) antibody is Catalog # AAP52607 (Previous Catalog # AAPY03686) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C6orf150 |
Uniprot ID |
Q8N884 |
Protein Name |
cyclic GMP-AMP synthase |
Publications |
Schoggins, J. W. et al. A diverse range of gene products are effectors of the type I interferon antiviral response. Nature 472, 481-5 (2011). 21478870 |
Protein Accession # |
NP_612450 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_138441 |
Tested Species Reactivity |
Human |
Gene Symbol |
CGAS |
Predicted Species Reactivity |
Human, Cow, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100% |
Image 1 | Human Jurkat
| Host: Rabbit Target Name: MB21D1 Sample Tissue: Human Jurkat Antibody Dilution: 1.0ug/ml |
|
|