CGAS Antibody - middle region (ARP52607_P050)

Data Sheet
 
Product Number ARP52607_P050
Product Page www.avivasysbio.com/cgas-antibody-middle-region-arp52607-p050.html
Name CGAS Antibody - middle region (ARP52607_P050)
Protein Size (# AA) 522 amino acids
Molecular Weight 59kDa
NCBI Gene Id 115004
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name cyclic GMP-AMP synthase
Alias Symbols MB21D1, h-cGAS, C6orf150
Peptide Sequence Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101
Protein Interactions UBC; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CGAS (ARP52607_P050) antibody
Blocking Peptide For anti-CGAS (ARP52607_P050) antibody is Catalog # AAP52607 (Previous Catalog # AAPY03686)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C6orf150
Uniprot ID Q8N884
Protein Name cyclic GMP-AMP synthase
Publications

Schoggins, J. W. et al. A diverse range of gene products are effectors of the type I interferon antiviral response. Nature 472, 481-5 (2011). 21478870

Protein Accession # NP_612450
Purification Affinity Purified
Nucleotide Accession # NM_138441
Tested Species Reactivity Human
Gene Symbol CGAS
Predicted Species Reactivity Human, Cow, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100%
Image 1
Human Jurkat
Host: Rabbit
Target Name: MB21D1
Sample Tissue: Human Jurkat
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com