Loading...
Catalog No: ARP61171_P050
Price: $0.00
SKU
ARP61171_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CD9 (ARP61171_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CD9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 92%; Goat: 93%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Peptide SequenceSynthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CD9 (ARP61171_P050) antibody is Catalog # AAP61171 (Previous Catalog # AAPP47322)
Publications

Isolation and Characterization of Small Extracellular Vesicles from Porcine Blood Plasma, Cerebrospinal Fluid, and Seminal Plasma. Proteomes. 7, (2019). 31027284

Description
Gene SymbolCD9
Gene Full NameCD9 molecule
Alias SymbolsMIC3, MRP-1, BTCC-1, DRAP-27, TSPAN29, TSPAN-29
NCBI Gene Id928
Protein NameCD9 antigen
Description of TargetThis gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Uniprot IDP21926
Protein Accession #NP_001760
Nucleotide Accession #NM_001769
Protein Size (# AA)228
Molecular Weight25 kDa
Protein InteractionsADRB2; UBC; VKORC1; CLN8; ATP6V1B1; LGALS3BP; ELAVL1; IGSF8; CD81; ITGA3; TSPAN4; ADAM2; PTGFRN; SERPINH1; ITGA2; PRKCA; CD36; KIT; CD63; CD53; ITGB1; ITGA5; HBEGF; CD59; CD38; CD19; CD46; CD82;
  1. What is the species homology for "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CD9 Antibody - N-terminal region (ARP61171_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    This target may also be called "MIC3, MRP-1, BTCC-1, DRAP-27, TSPAN29, TSPAN-29" in publications.

  5. What is the shipping cost for "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CD9 Antibody - N-terminal region (ARP61171_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CD9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CD9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CD9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CD9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CD9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CD9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CD9 Antibody - N-terminal region (ARP61171_P050)
Your Rating
We found other products you might like!