CD9 Antibody - N-terminal region (ARP61171_P050)

Data Sheet
 
Product Number ARP61171_P050
Product Page www.avivasysbio.com/cd9-antibody-n-terminal-region-arp61171-p050.html
Name CD9 Antibody - N-terminal region (ARP61171_P050)
Protein Size (# AA) 228 amino acids
Molecular Weight 25 kDa
NCBI Gene Id 928
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CD9 molecule
Description
Alias Symbols MIC3, MRP-1, BTCC-1, DRAP-27, TSPAN29, TSPAN-29
Peptide Sequence Synthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Protein Interactions ADRB2; UBC; VKORC1; CLN8; ATP6V1B1; LGALS3BP; ELAVL1; IGSF8; CD81; ITGA3; TSPAN4; ADAM2; PTGFRN; SERPINH1; ITGA2; PRKCA; CD36; KIT; CD63; CD53; ITGB1; ITGA5; HBEGF; CD59; CD38; CD19; CD46; CD82;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CD9 (ARP61171_P050) antibody
Blocking Peptide For anti-CD9 (ARP61171_P050) antibody is Catalog # AAP61171 (Previous Catalog # AAPP47322)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CD9
Uniprot ID P21926
Protein Name CD9 antigen
Publications

Isolation and Characterization of Small Extracellular Vesicles from Porcine Blood Plasma, Cerebrospinal Fluid, and Seminal Plasma. Proteomes. 7, (2019). 31027284

Protein Accession # NP_001760
Purification Affinity Purified
Nucleotide Accession # NM_001769
Tested Species Reactivity Human, Mouse
Gene Symbol CD9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 92%; Goat: 93%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Image 1
Human Fetal heart
CD9 antibody - N-terminal region (ARP61171_P050) validated by WB using Fetal Heart Lysate at 1.0ug/ml.
Image 2
Mouse fibroblast
Sample Type: mouse fibroblast lusate (10ug) Primary Dilution: 1:2000 (1% BSA) Secondary Dilution: 1:2000 (5% milk) Image Submitted By: Anonymous researcher
Image 3
Human MCF7 Whole Cell
Host: Rabbit
Target Name: CD9
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 1ug/ml
Image 4

25 ug of THP-1 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/mL of antibody.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com