| Sku |
AAP61171 |
| Old sku |
AAPP47322 |
| Price |
$99.00 |
| Name |
CD9 Peptide - N-terminal region (AAP61171) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CD9 |
| Alias symbols |
5H9, BA2, BTCC-1, DRAP-27, GIG2, MIC3, MRP-1, P24, TSPAN29, TSPAN-29 |
| Gene id |
928 |
| Description of target |
This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. |
| Swissprot id |
P21926 |
| Protein accession num |
NP_001760 |
| Nucleotide accession num |
NM_001769 |
| Protein size |
228 amino acids |
| Molecular weight |
25kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV |
| Partner proteins |
ADAM2,CD19,CD36,CD38,CD53,CD59,CD63,CD81,HBEGF,IGSF8,ITGA2,ITGA3,ITGA5,ITGB1,KIT,PRKCA,PTGFRN,SERPINH1,TSPAN4,CD19,CD36,CD46,CD53,CD63,CD81,CD82,IGSF8,ITGA3,ITGA5,ITGB1,KIT,PRKCA,PTGFRN,SERPINH1,TSPAN4 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CD9 Antibody (ARP61171_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
